![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG000266t2 | ||||||||
Common Name | TCM_000266 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 226aa MW: 26182.9 Da PI: 10.1133 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.5 | 4e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien++nrqvt+skRrngi+KKA+EL vLCda+v++i+fss+gk++e++s Thecc1EG000266t2 9 KKIENTTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSSSGKFHEFIS 59 68***********************************************86 PP | |||||||
2 | K-box | 85 | 1.5e-28 | 71 | 169 | 1 | 98 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreq.RhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 yqk+ g +l+++++e++q+++++Lk+ ++ L+re+ R+++GedL++L++keLq Le ++ +sl+ +R++K++++++q+++ +kk ++l++++ Thecc1EG000266t2 71 YQKTLGIDLWSSHYEKMQENYRRLKEINNRLRREIsRQRIGEDLDDLNIKELQALEAKMASSLEAVRQRKYHVIKTQTDTYKKKVRNLEQRHA 163 78899999************************6543********************************************************* PP K-box 93 aLrkkl 98 +L l Thecc1EG000266t2 164 NLVLDL 169 997665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.0E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.632 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.08E-38 | 2 | 80 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-36 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.7E-19 | 82 | 166 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.556 | 84 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MGRGKIEIKK IENTTNRQVT YSKRRNGIFK KAQELTVLCD AKVSLIMFSS SGKFHEFISP 60 NISTKTFFDL YQKTLGIDLW SSHYEKMQEN YRRLKEINNR LRREISRQRI GEDLDDLNIK 120 ELQALEAKMA SSLEAVRQRK YHVIKTQTDT YKKKVRNLEQ RHANLVLDLE AKLEDGIVEN 180 EAYYESSMGL ANGASNLYAL RLHQNHQVNL LHHGGRFGPN DLRLA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-15 | 1 | 62 | 1 | 62 | MEF2 CHIMERA |
6byy_B | 5e-15 | 1 | 62 | 1 | 62 | MEF2 CHIMERA |
6byy_C | 5e-15 | 1 | 62 | 1 | 62 | MEF2 CHIMERA |
6byy_D | 5e-15 | 1 | 62 | 1 | 62 | MEF2 CHIMERA |
6bz1_A | 5e-15 | 1 | 62 | 1 | 62 | MEF2 CHIMERA |
6bz1_B | 5e-15 | 1 | 62 | 1 | 62 | MEF2 CHIMERA |
6bz1_C | 5e-15 | 1 | 62 | 1 | 62 | MEF2 CHIMERA |
6bz1_D | 5e-15 | 1 | 62 | 1 | 62 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007046775.1 | 1e-167 | PREDICTED: floral homeotic protein PMADS 1 isoform X1 | ||||
Swissprot | Q003J2 | 1e-117 | TM6_VITVI; Agamous-like MADS-box protein TM6 | ||||
TrEMBL | A0A061DFV0 | 1e-165 | A0A061DFV0_THECC; Floral homeotic protein DEFICIENS, putative isoform 2 | ||||
STRING | EOX90931 | 1e-163 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 5e-69 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG000266t2 |
Entrez Gene | 18610825 |
Publications ? help Back to Top | |||
---|---|---|---|
|