![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_01748.1_g00004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 228aa MW: 26859.8 Da PI: 4.666 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 57.2 | 2.8e-18 | 31 | 82 | 5 | 56 |
SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +f++eq++ Le Fe++ + +++ +LA++lgL+ rqV +WFqN+Ra++k Rsa1.0_01748.1_g00004.1 31 KRFSEEQIKSLEVIFESETRLEPRRKVQLARELGLQPRQVAIWFQNKRARWK 82 57*************************************************9 PP | |||||||
2 | HD-ZIP_I/II | 117.9 | 5.7e-38 | 29 | 120 | 2 | 93 |
HD-ZIP_I/II 2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 +++r+s+eq+k+LE Fe+e++Lep+rKv+lareLglqprqva+WFqn+RAR+k+kqlEk+y+ L ++y++l+++ e ++ke+++L Rsa1.0_01748.1_g00004.1 29 NHKRFSEEQIKSLEVIFESETRLEPRRKVQLARELGLQPRQVAIWFQNKRARWKSKQLEKEYNILSANYNNLASQFEIMKKEKQAL 114 579*********************************************************************************** PP HD-ZIP_I/II 88 reelke 93 +el++ Rsa1.0_01748.1_g00004.1 115 VSELQR 120 **9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 5.43E-18 | 10 | 86 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 2.7E-16 | 23 | 88 | IPR001356 | Homeobox domain |
PROSITE profile | PS50071 | 16.665 | 24 | 84 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 7.8E-19 | 31 | 91 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 1.2E-15 | 31 | 82 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.11E-13 | 32 | 85 | No hit | No description |
PRINTS | PR00031 | 4.9E-6 | 55 | 64 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 59 | 82 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 4.9E-6 | 64 | 80 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 1.2E-14 | 84 | 125 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009615 | Biological Process | response to virus | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MEEGDFFSCF SEINSGMTMN KKKMRKGTNH KRFSEEQIKS LEVIFESETR LEPRRKVQLA 60 RELGLQPRQV AIWFQNKRAR WKSKQLEKEY NILSANYNNL ASQFEIMKKE KQALVSELQR 120 LNEEMKKTRE ERNDECCAEQ RVALSSSTWS DNGNYEPEVR LNQGIVLCND DIKSEYFGFE 180 EESNHELMNI VDQADDSGLT SSDNWGDFNS ESLLDQSSSN YPWWDFWS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:11374882, ECO:0000269|PubMed:15604708}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00013 | PBM | Transfer from AT3G61890 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_01748.1_g00004.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA), by cold and salt stress. {ECO:0000269|PubMed:15369784, ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:9617808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT000602 | 0.0 | KT000602.1 Brassica napus note R1 line homeobox-leucine zipper protein (ATHB-12) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009138744.1 | 1e-159 | PREDICTED: homeobox-leucine zipper protein ATHB-12-like | ||||
Swissprot | Q9M276 | 1e-112 | ATB12_ARATH; Homeobox-leucine zipper protein ATHB-12 | ||||
TrEMBL | A0A397ZGR3 | 1e-158 | A0A397ZGR3_BRACM; Uncharacterized protein | ||||
STRING | Bra014417.1-P | 1e-158 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2498 | 28 | 74 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G61890.1 | 1e-115 | homeobox 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|