PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Araha.65484s0001.1.p

Organism

Arabidopsis halleri

Taxonomic ID

81970

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WOX

Protein Properties

Length: 148aa MW: 17623.2 Da PI: 10.146

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araha.65484s0001.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	63.6	2.8e-20	6	66	2	57
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++R+++t+eql +Lee++++ r+p+a ++++++++l +++ ++V++WFqN++a++++ Araha.65484s0001.1.p 6 STRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygRIEGKNVFYWFQNHKARDRQ 66 58***************99***********************************996 PP
2	Wus_type_Homeobox	121.6	3.1e-39	5	67	2	64
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 a+tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk Araha.65484s0001.1.p 5 ASTRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 67 589***********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00389	0.0013	4	71	IPR001356	Homeobox domain
SuperFamily	SSF46689	2.35E-11	7	67	IPR009057	Homeodomain-like
CDD	cd00086	2.84E-4	7	67	No hit	No description
Pfam	PF00046	5.6E-18	7	66	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	1.7E-7	8	66	IPR009057	Homeodomain-like
PROSITE profile	PS50071	9.766	12	67	IPR001356	Homeobox domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0008283	Biological Process	cell proliferation
GO:0009908	Biological Process	flower development
GO:0009943	Biological Process	adaxial/abaxial axis specification
GO:0009947	Biological Process	centrolateral axis specification
GO:0010865	Biological Process	stipule development
GO:0048513	Biological Process	animal organ development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 148 aa Download sequence Send to blast
MSPVASTRWC PTPEQLMILE EMYRSGIRTP NAVQIQQITA HLAFYGRIEG KNVFYWFQNH 60 KARDRQKLRK KLAKQLHQQQ HQLQLQLQQI KPKPMSSMMS QPVNNTIIDH HNPYHHHHHN 120 LHHNHHRPYD HMSFACCSHP SPMCLPHQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:15169755}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araha.65484s0001.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB058920	0.0	AB058920.1 Arabidopsis thaliana PRS mRNA for PRESSED FLOWER, complete cds.
GenBank	AC007171	0.0	AC007171.5 Arabidopsis thaliana chromosome 2 clone T8O18 map mi54, complete sequence.
GenBank	AY251397	0.0	AY251397.1 Arabidopsis thaliana PRS/WOX3 protein mRNA, complete cds.
GenBank	CP002685	0.0	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBank	DQ446575	0.0	DQ446575.1 Arabidopsis thaliana clone pENTR221-At2g28610 homeobox-leucine zipper transcription factor (At2g28610) mRNA, complete cds.
GenBank	DQ653028	0.0	DQ653028.1 Arabidopsis thaliana clone 0000017226_0000012059 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002879170.1	1e-106	WUSCHEL-related homeobox 3
Swissprot	Q9SIB4	4e-77	WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBL	D7LJM2	1e-105	D7LJM2_ARALL; Uncharacterized protein
STRING	fgenesh2_kg.4__832__AT2G28610.1	1e-106	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7480	26	42

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G28610.1	1e-68	WOX family protein

Link Out ? help Back to Top
Phytozome	Araha.65484s0001.1.p

Publications ? help Back to Top
Chandler JW,Werr W Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation. J. Exp. Bot., 2014. 65(12): p. 3097-110 [PMID:24744428] Niu L, et al. LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula. Plant J., 2015. 81(3): p. 480-92 [PMID:25492397] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Guan C, et al. Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086]