PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_49.26 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 169aa MW: 18695.3 Da PI: 11.0857 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 50.7 | 3.8e-16 | 90 | 141 | 5 | 56 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+ e++ ++ evm.model.supercontig_49.26 90 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQEKIMEMQ 141 79******************************************99999886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 9.4E-16 | 84 | 138 | No hit | No description |
SMART | SM00338 | 6.5E-14 | 86 | 151 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.496 | 88 | 139 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.5E-12 | 90 | 139 | No hit | No description |
CDD | cd14707 | 4.82E-24 | 90 | 144 | No hit | No description |
Pfam | PF00170 | 4.2E-14 | 90 | 142 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 93 | 108 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MATNFNLKNF GNEPLADGGT SGNRPLANVP LTRQPSGRAM GVGLLQTQLS SNGIGKNNGD 60 TSSVSPVPYA FNGGFRGRKC SGAVEKVVER RQRRMIKNRE SAARSRARKQ AYTMELEAEV 120 AKLKEENEEL QKKQEKIMEM QKNQVLEMLN GQRGSKLRCL RRTQTGPW* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in ABA and stress responses and acts as a positive component of glucose signal transduction. Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_49.26 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA), cold and glucose. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012071654.1 | 5e-66 | ABSCISIC ACID-INSENSITIVE 5-like protein 5 | ||||
Refseq | XP_018805792.1 | 7e-66 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2 | ||||
Refseq | XP_018805793.1 | 7e-66 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2 | ||||
Refseq | XP_020534831.1 | 5e-66 | ABSCISIC ACID-INSENSITIVE 5-like protein 5 | ||||
Swissprot | Q9M7Q4 | 4e-56 | AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5 | ||||
TrEMBL | A0A067D5D2 | 1e-65 | A0A067D5D2_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A067GWQ2 | 3e-65 | A0A067GWQ2_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A067L1G8 | 1e-64 | A0A067L1G8_JATCU; Uncharacterized protein | ||||
TrEMBL | A0A2I4DF73 | 2e-64 | A0A2I4DF73_JUGRE; ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2 | ||||
STRING | evm.model.supercontig_49.26 | 1e-119 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM734 | 27 | 129 | Representative plant | OGRP10063 | 7 | 11 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G45249.1 | 6e-35 | abscisic acid responsive elements-binding factor 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_49.26 |
Publications ? help Back to Top | |||
---|---|---|---|
|