PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

bZIP

Protein Properties

Length: 169aa MW: 18695.3 Da PI: 11.0857

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_49.26	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	50.7	3.8e-16	90	141	5	56
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+ e++ ++ evm.model.supercontig_49.26 90 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQEKIMEMQ 141 79******************************************99999886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	9.4E-16	84	138	No hit	No description
SMART	SM00338	6.5E-14	86	151	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.496	88	139	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	4.5E-12	90	139	No hit	No description
CDD	cd14707	4.82E-24	90	144	No hit	No description
Pfam	PF00170	4.2E-14	90	142	IPR004827	Basic-leucine zipper domain
PROSITE pattern	PS00036	0	93	108	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MATNFNLKNF GNEPLADGGT SGNRPLANVP LTRQPSGRAM GVGLLQTQLS SNGIGKNNGD 60 TSSVSPVPYA FNGGFRGRKC SGAVEKVVER RQRRMIKNRE SAARSRARKQ AYTMELEAEV 120 AKLKEENEEL QKKQEKIMEM QKNQVLEMLN GQRGSKLRCL RRTQTGPW*

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in ABA and stress responses and acts as a positive component of glucose signal transduction. Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269\|PubMed:11005831, ECO:0000269\|PubMed:15361142, ECO:0000269\|PubMed:16284313, ECO:0000269\|PubMed:16463099}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_49.26

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA), cold and glucose. {ECO:0000269\|PubMed:10636868, ECO:0000269\|PubMed:11005831, ECO:0000269\|PubMed:15361142, ECO:0000269\|PubMed:16284313, ECO:0000269\|PubMed:16463099}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012071654.1	5e-66	ABSCISIC ACID-INSENSITIVE 5-like protein 5
Refseq	XP_018805792.1	7e-66	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2
Refseq	XP_018805793.1	7e-66	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2
Refseq	XP_020534831.1	5e-66	ABSCISIC ACID-INSENSITIVE 5-like protein 5
Swissprot	Q9M7Q4	4e-56	AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBL	A0A067D5D2	1e-65	A0A067D5D2_CITSI; Uncharacterized protein
TrEMBL	A0A067GWQ2	3e-65	A0A067GWQ2_CITSI; Uncharacterized protein
TrEMBL	A0A067L1G8	1e-64	A0A067L1G8_JATCU; Uncharacterized protein
TrEMBL	A0A2I4DF73	2e-64	A0A2I4DF73_JUGRE; ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X2
STRING	evm.model.supercontig_49.26	1e-119	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM734	27	129
Representative plant	OGRP10063	7	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G45249.1	6e-35	abscisic acid responsive elements-binding factor 2

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_49.26

Publications ? help Back to Top
Gao S, et al. ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis. Mol Plant, 2016. 9(9): p. 1272-1285 [PMID:27373216] Seok HY, et al. Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response. Planta, 2017. 245(2): p. 329-341 [PMID:27770200]