![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015885414.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 230aa MW: 25510.2 Da PI: 8.6593 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.1 | 9.6e-19 | 38 | 83 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd l ++v+++G+++W++I+r+++ gR++k+c++rw + XP_015885414.1 38 KGPWSAEEDRVLTRLVERYGPRNWSLISRHIN-GRSGKSCRLRWCNQ 83 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 55.2 | 1.6e-17 | 92 | 134 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ XP_015885414.1 92 PFSPAEDETILAAHARYGNR-WATIARLLP-GRTDNAVKNHWNST 134 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 27.016 | 33 | 88 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.67E-32 | 35 | 131 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.9E-17 | 37 | 86 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-17 | 38 | 83 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.6E-25 | 39 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.18E-15 | 40 | 82 | No hit | No description |
SMART | SM00717 | 3.0E-15 | 89 | 137 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.962 | 90 | 139 | IPR017930 | Myb domain |
CDD | cd00167 | 2.76E-12 | 92 | 135 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-23 | 92 | 139 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-14 | 92 | 134 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MEAMNRCSSS TSSSDSSSSE SSLSGKTPRN PNKPERIKGP WSAEEDRVLT RLVERYGPRN 60 WSLISRHING RSGKSCRLRW CNQLSPSVEH RPFSPAEDET ILAAHARYGN RWATIARLLP 120 GRTDNAVKNH WNSTLKRRVR EQQMDGHHRN ADHDVGSGSG PCINGPLEDD PLTALTLAPP 180 GIGVSGGPSM AEERRSESVP TGFWDVMRDV IAREVRDYVT STFAENSGFQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 4e-43 | 34 | 139 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 4e-43 | 34 | 139 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015885414.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015885414.1 | 1e-170 | transcription factor MYB44-like | ||||
Swissprot | Q9FDW1 | 6e-57 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | M5XHQ5 | 1e-108 | M5XHQ5_PRUPE; Uncharacterized protein | ||||
STRING | EMJ25026 | 1e-109 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5074 | 32 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 1e-58 | myb domain protein r1 |