![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015883885.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 76aa MW: 8616.63 Da PI: 4.8541 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 31.2 | 5.2e-10 | 26 | 67 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++ ++++E+ l+++ ++ G + W+ Ia +++ gRt++++k ++ XP_015883885.1 26 KLQFSKDEETLIKRMYNLVGER-WAIIAGRIP-GRTAEEIKKYL 67 6789******************.*********.********998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.979 | 21 | 75 | IPR017930 | Myb domain |
SMART | SM00717 | 3.7E-6 | 25 | 73 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-8 | 27 | 67 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.58E-8 | 28 | 71 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.0E-10 | 28 | 66 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.88E-6 | 29 | 66 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MADLEGSSTN KTQADSRAEE ISEESKLQFS KDEETLIKRM YNLVGERWAI IAGRIPGRTA 60 EEIKKYLTST YSSKVE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015883885.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015883885.1 | 2e-48 | MYB-like transcription factor ETC1 isoform X1 | ||||
Swissprot | Q9LNI5 | 4e-13 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
TrEMBL | A0A218WYL8 | 7e-28 | A0A218WYL8_PUNGR; Uncharacterized protein | ||||
STRING | XP_010052817.1 | 7e-29 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2692 | 31 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46410.1 | 1e-15 | MYB_related family protein |