PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013611131.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 201aa MW: 22534.2 Da PI: 6.0261 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175.3 | 6.1e-55 | 45 | 141 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrf+Pianv+rim+++lPa+akis+d+ket+qecvse+isfvt+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yreleg XP_013611131.1 45 VREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFVTGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEG 139 69********************************************************************************************* PP NF-YB 96 ek 97 ++ XP_013611131.1 140 DR 141 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.7E-50 | 40 | 142 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.69E-37 | 48 | 141 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.9E-25 | 51 | 115 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.2E-17 | 79 | 97 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 82 | 98 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.2E-17 | 98 | 116 | No hit | No description |
PRINTS | PR00615 | 6.2E-17 | 117 | 135 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MERGGFHGYG KFSLNTTTNP ESGMQLSELN QPTKTADGGQ EECTVREQDR FMPIANVIRI 60 MRRILPAHAK ISDDSKETIQ ECVSEYISFV TGEANERCQR EQRKTITAED VLWAMSKLGF 120 DDYIEPLTLY LHRYRELEGD RGVNCGAGSV SMTNGMVVKR PNGTMAEYGA YMAPYHYRHQ 180 NGFAYSGNEP NSKMGGSSSS F |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 6e-65 | 44 | 136 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013611131.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC155343 | 0.0 | AC155343.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH077A05, complete sequence. | |||
GenBank | EU371727 | 0.0 | EU371727.1 Brassica napus leafy cotyledon 1-like protein (L1L) gene, complete cds. | |||
GenBank | KC787667 | 0.0 | KC787667.1 Brassica napus transcription factor subunit NF-YB6B (NF-YB6B) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013611131.1 | 1e-152 | PREDICTED: nuclear transcription factor Y subunit B-6-like isoform X2 | ||||
Swissprot | Q84W66 | 1e-121 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A0D3E7A5 | 1e-148 | A0A0D3E7A5_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g069720.1 | 1e-149 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.1 | 1e-124 | nuclear factor Y, subunit B6 |