PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G47670.1

Common Name

L1L, MNJ7.26, NFYB6, NF-YB6

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NF-YB

Protein Properties

Length: 234aa MW: 26136.3 Da PI: 7.1789

Description

nuclear factor Y, subunit B6

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G47670.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	174.2	1.3e-54	56	152	1	97
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 vreqdrf+Pianv+rim+++lPa+akis+d+ket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yrelege+ AT5G47670.1 56 VREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEGER 152 69*********************************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	8.2E-50	52	153	IPR009072	Histone-fold
SuperFamily	SSF47113	3.19E-37	59	152	IPR009072	Histone-fold
Pfam	PF00808	9.5E-25	62	126	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.1E-16	90	108	No hit	No description
PROSITE pattern	PS00685	0	93	109	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.1E-16	109	127	No hit	No description
PRINTS	PR00615	1.1E-16	128	146	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009738	Biological Process	abscisic acid-activated signaling pathway
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0033613	Molecular Function	activating transcription factor binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009009	anatomy	plant embryo
PO:0004507	developmental stage	plant embryo bilateral stage

Sequence ? help Back to Top
Protein Sequence Length: 234 aa Download sequence Send to blast
MERGGFHGYR KLSVNNTTPS PPGLAANFLM AEGSMRPPEF NQPNKTSNGG EEECTVREQD 60 RFMPIANVIR IMRRILPAHA KISDDSKETI QECVSEYISF ITGEANERCQ REQRKTITAE 120 DVLWAMSKLG FDDYIEPLTL YLHRYRELEG ERGVSCSAGS VSMTNGLVVK RPNGTMTEYG 180 AYGPVPGIHM AQYHYRHQNG FVFSGNEPNS KMSGSSSGAS GARVEVFPTQ QHKY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5g49_A	1e-64	55	147	5	97	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.49140	0.0	seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	248754_at	0.0
Expression Atlas	AT5G47670	-
AtGenExpress	AT5G47670	-
ATTED-II	AT5G47670	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269\|PubMed:12509518}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269\|PubMed:11250072, ECO:0000269\|PubMed:12509518, ECO:0000269\|PubMed:17322342}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes LEC1-Like (L1L), closely related to LEC1 (Leafy Cotyledon1). Functions as a regulator of embryo development.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269\|PubMed:12509518, ECO:0000269\|PubMed:17322342}.

Function -- GeneRIF ? help Back to Top
LEC1 and LEC1-LIKE activate the CRUCIFERIN C and SUCROSE SYNTHASE 2 (SUS2) promoters in combination with an NF-YC subunit through the interaction with a seed-specific ABA-response element (ABRE) binding bZIP factor, bZIP67. [L1L] [LEC1-LIKE] [PMID: 19207209]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G47670.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G54830, AT1G56170
IntAct	Search Q84W66

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Altered response to abscisic acid (ABA). {ECO:0000269\|PubMed:17322342}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G47670

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY138461	0.0	AY138461.1 Arabidopsis thaliana leafy cotyledon 1-like L1L protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001318754.1	1e-177	nuclear factor Y, subunit B6
Refseq	NP_199578.2	1e-177	nuclear factor Y, subunit B6
Swissprot	Q84W66	1e-178	NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBL	A0A178UB79	1e-176	A0A178UB79_ARATH; NF-YB6
STRING	AT5G47670.1	1e-176	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM9896	26	36
Representative plant	OGRP168	17	170

Link Out ? help Back to Top
Phytozome	AT5G47670.1
Entrez Gene	834818
iHOP	AT5G47670
wikigenes	AT5G47670

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Gusmaroli G,Tonelli C,Mantovani R Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana. Gene, 2001. 264(2): p. 173-85 [PMID:11250072] Gusmaroli G,Tonelli C,Mantovani R Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits. Gene, 2002. 283(1-2): p. 41-8 [PMID:11867211] Ruuska SA,Girke T,Benning C,Ohlrogge JB Contrapuntal networks of gene expression during Arabidopsis seed filling. Plant Cell, 2002. 14(6): p. 1191-206 [PMID:12084821] Kwong RW, et al. LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development. Plant Cell, 2003. 15(1): p. 5-18 [PMID:12509518] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Wenkel S, et al. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell, 2006. 18(11): p. 2971-84 [PMID:17138697] Warpeha KM, et al. The GCR1, GPA1, PRN1, NF-Y signal chain mediates both blue light and abscisic acid responses in Arabidopsis. Plant Physiol., 2007. 143(4): p. 1590-600 [PMID:17322342] Mu J, et al. LEAFY COTYLEDON1 is a key regulator of fatty acid biosynthesis in Arabidopsis. Plant Physiol., 2008. 148(2): p. 1042-54 [PMID:18689444] Yamamoto A, et al. Arabidopsis NF-YB subunits LEC1 and LEC1-LIKE activate transcription by interacting with seed-specific ABRE-binding factors. Plant J., 2009. 58(5): p. 843-56 [PMID:19207209] Le BH, et al. Global analysis of gene activity during Arabidopsis seed development and identification of seed-specific transcription factors. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(18): p. 8063-70 [PMID:20385809] Tan H, et al. Enhanced seed oil production in canola by conditional expression of Brassica napus LEAFY COTYLEDON1 and LEC1-LIKE in developing seeds. Plant Physiol., 2011. 156(3): p. 1577-88 [PMID:21562329] Hackenberg D, et al. Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y. Mol Plant, 2012. 5(4): p. 876-88 [PMID:22199235] Calvenzani V, et al. Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits. PLoS ONE, 2012. 7(8): p. e42902 [PMID:22912760] Jia H,McCarty DR,Suzuki M Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression. Plant Physiol., 2013. 163(3): p. 1293-305 [PMID:24043445] Kim HU, et al. Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues. FEBS Open Bio, 2013. 4: p. 25-32 [PMID:24363987] Sato H, et al. Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits. Plant Cell, 2014. 26(12): p. 4954-73 [PMID:25490919] Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants. Mol Plant, 2017. 10(4): p. 645-648 [PMID:27871811] Li D, et al. MYB89 Transcription Factor Represses Seed Oil Accumulation. Plant Physiol., 2017. 173(2): p. 1211-1225 [PMID:27932421] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Han JD, et al. Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program. Front Plant Sci, 2017. 8: p. 439 [PMID:28421087]