![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011075657.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 187aa MW: 21888.7 Da PI: 4.8526 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 112.8 | 3.7e-35 | 14 | 141 | 2 | 127 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikev.diykvePwdLp.kkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 p GfrFhPtd el+ +yL +k++g++l+ +e+i ++ ++y+++P +Lp ++k+ +eke yfF+ ++ k++ g+ + r+t +gyWka +d +++ XP_011075657.1 14 PLGFRFHPTDVELLLYYLLPKLKGEDLSSSEFIMDFlGVYQHDPDRLPlDQFKHgREKEAYFFTLEEIKNSVGEGPVRTTPTGYWKAYREDVPIH 108 89************************99999977766***********755555266799*********************************** PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyr 127 + ++e +g k+ L fy+++ p+g++tdW m ey XP_011075657.1 109 H-NQEIIGFKNKLLFYRENVPNGTQTDWKMTEYF 141 *.999****************************5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.4E-38 | 9 | 166 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 36.215 | 13 | 166 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.0E-17 | 14 | 140 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MDFIQRLLSD ADFPLGFRFH PTDVELLLYY LLPKLKGEDL SSSEFIMDFL GVYQHDPDRL 60 PLDQFKHGRE KEAYFFTLEE IKNSVGEGPV RTTPTGYWKA YREDVPIHHN QEIIGFKNKL 120 LFYRENVPNG TQTDWKMTEY FCSPSWIATT STSTVGRYVV CKVRQKMRAE EDEPLLEEEN 180 GFIEGSK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-22 | 8 | 171 | 12 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-22 | 8 | 171 | 12 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-22 | 8 | 171 | 12 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-22 | 8 | 171 | 12 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-22 | 8 | 171 | 15 | 173 | NAC domain-containing protein 19 |
3swm_B | 3e-22 | 8 | 171 | 15 | 173 | NAC domain-containing protein 19 |
3swm_C | 3e-22 | 8 | 171 | 15 | 173 | NAC domain-containing protein 19 |
3swm_D | 3e-22 | 8 | 171 | 15 | 173 | NAC domain-containing protein 19 |
3swp_A | 3e-22 | 8 | 171 | 15 | 173 | NAC domain-containing protein 19 |
3swp_B | 3e-22 | 8 | 171 | 15 | 173 | NAC domain-containing protein 19 |
3swp_C | 3e-22 | 8 | 171 | 15 | 173 | NAC domain-containing protein 19 |
3swp_D | 3e-22 | 8 | 171 | 15 | 173 | NAC domain-containing protein 19 |
4dul_A | 3e-22 | 8 | 171 | 12 | 170 | NAC domain-containing protein 19 |
4dul_B | 3e-22 | 8 | 171 | 12 | 170 | NAC domain-containing protein 19 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011075657.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011075657.1 | 1e-139 | NAC transcription factor 29-like | ||||
TrEMBL | A0A2G9H1T9 | 4e-44 | A0A2G9H1T9_9LAMI; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA15132 | 6 | 8 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 1e-22 | NAC domain containing protein 36 |