![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010518736.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 186aa MW: 21371.1 Da PI: 7.1788 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 172.5 | 4.4e-54 | 39 | 135 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdr++Pianv+rim+++lP +akis++aket+qecvse+isfvt+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yreleg XP_010518736.1 39 VREQDRYMPIANVIRIMRRMLPVQAKISDEAKETIQECVSEYISFVTGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEG 133 69********************************************************************************************9 PP NF-YB 96 ek 97 e+ XP_010518736.1 134 ER 135 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.4E-50 | 34 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.47E-38 | 42 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.8E-25 | 45 | 109 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.2E-17 | 73 | 91 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 76 | 92 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.2E-17 | 92 | 110 | No hit | No description |
PRINTS | PR00615 | 5.2E-17 | 111 | 129 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MERGGYHGFR KHSNTTTTCG SVYMPAKFMV QETGEECRVR EQDRYMPIAN VIRIMRRMLP 60 VQAKISDEAK ETIQECVSEY ISFVTGEANE RCQREQRKTI TAEDVLWAMS KLGFDDYIEP 120 LTLYLHRYRE LEGERAVSVS GSLLVKRADE YGHFHPNAHS GFFFVPKMDG SSSTTTGPRV 180 DGHQKY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 6e-60 | 34 | 130 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010518736.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010518736.1 | 1e-139 | PREDICTED: nuclear transcription factor Y subunit B-6 isoform X1 | ||||
Swissprot | Q84W66 | 4e-75 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A0D3E7A5 | 1e-73 | A0A0D3E7A5_BRAOL; Uncharacterized protein | ||||
STRING | XP_010518736.1 | 1e-139 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9896 | 26 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.1 | 1e-77 | nuclear factor Y, subunit B6 |