PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009114256.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 209aa MW: 23281.1 Da PI: 6.1293 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 168.5 | 8.1e-53 | 51 | 147 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdr++Pianv+rim+++lPanakis+d+ket+qecvse+i+f t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yreleg XP_009114256.1 51 VREQDRVMPIANVIRIMRRILPANAKISDDSKETIQECVSEYIGFETGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEG 145 69********************************************************************************************* PP NF-YB 96 ek 97 ++ XP_009114256.1 146 DR 147 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.5E-47 | 46 | 147 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.87E-35 | 54 | 147 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.4E-22 | 58 | 121 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.7E-14 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 1.7E-14 | 104 | 122 | No hit | No description |
PRINTS | PR00615 | 1.7E-14 | 123 | 141 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MERGGFHGYG KFSLNNTTNP GKLLMAESGM QLPEPNQPTK TANGGQEECT VREQDRVMPI 60 ANVIRIMRRI LPANAKISDD SKETIQECVS EYIGFETGEA NERCQREQRK TITAEDVLWA 120 MSKLGFDDYI EPLTLYLHRY RELEGDRGVN CGVGSVSMTN GMVVKRPNGT MAEYGPYGTM 180 APYRYHHQNG FAYSGNDPNS KMGGSSSSF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-61 | 50 | 142 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009114256.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC155343 | 0.0 | AC155343.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH077A05, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009114256.1 | 1e-157 | PREDICTED: nuclear transcription factor Y subunit B-6 | ||||
Swissprot | Q84W66 | 1e-119 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | M4DLU0 | 1e-156 | M4DLU0_BRARP; Uncharacterized protein | ||||
STRING | Bra017471.1-P | 1e-157 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9896 | 26 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.1 | 1e-122 | nuclear factor Y, subunit B6 |