PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi07g30190.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 75aa MW: 8651.79 Da PI: 7.6255 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 55.5 | 1.1e-17 | 16 | 52 | 23 | 59 |
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 sYYrC+++gC+vkk+++r ++d+++v++tYeg+H h+ Vradi07g30190.1 16 SYYRCSYRGCNVKKQIQRHSKDEEIVVTTYEGTHSHP 52 9***********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00774 | 2.7E-8 | 9 | 53 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 6.7E-16 | 16 | 53 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 16.099 | 16 | 54 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.02E-14 | 16 | 53 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.4E-13 | 16 | 52 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MSDLTRPVDL LAALISYYRC SYRGCNVKKQ IQRHSKDEEI VVTTYEGTHS HPVEKTTESF 60 EQILRNHHIY SLTL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi07g30190.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 2e-84 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014508459.1 | 8e-37 | probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 9e-23 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A1S3URB0 | 2e-35 | A0A1S3URB0_VIGRR; probable WRKY transcription factor 75 | ||||
STRING | GLYMA08G01430.1 | 3e-33 | (Glycine max) | ||||
STRING | XP_007160017.1 | 2e-33 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF35387 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 4e-25 | WRKY DNA-binding protein 75 |