![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi05g05410.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 145aa MW: 16593.5 Da PI: 8.2542 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.7 | 1.8e-31 | 57 | 115 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K vk+++fprsYY+C++++C+vkk+++r ++d+++v++tYeg+H+h+ Vradi05g05410.1 57 LDDGYQWRKYGKKIVKNNTFPRSYYKCAHRECNVKKQIQRHSSDEEIVVTTYEGTHTHP 115 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.5E-31 | 43 | 115 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.84E-28 | 49 | 116 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.265 | 52 | 117 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.6E-35 | 57 | 116 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.4E-26 | 58 | 115 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MEKHQVMLHT ASTSTALSSH FKDVEKQVSE ISSQNQSDKE AKHHRYAFQT RSAVDVLDDG 60 YQWRKYGKKI VKNNTFPRSY YKCAHRECNV KKQIQRHSSD EEIVVTTYEG THTHPVDKSV 120 ETFDQILGNL LIGNLFNNAP PTLE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 47 | 114 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 47 | 114 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi05g05410.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 1e-101 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014499244.1 | 1e-106 | probable WRKY transcription factor 43 | ||||
Swissprot | Q9FYA2 | 4e-42 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A1S3TZQ9 | 1e-105 | A0A1S3TZQ9_VIGRR; probable WRKY transcription factor 43 | ||||
STRING | GLYMA06G17690.2 | 1e-67 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 5e-42 | WRKY DNA-binding protein 75 |