![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang03g06820.1 | ||||||||
Common Name | LR48_Vigan09g234500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 165aa MW: 18773.7 Da PI: 10.2144 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 117.2 | 6.4e-37 | 38 | 95 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnv vG+grrk k Vang03g06820.1 38 TEKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGALRNVAVGAGRRKGK 95 57899***************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 4.7E-31 | 40 | 95 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 2.0E-25 | 41 | 95 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 27.521 | 42 | 96 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 44 | 80 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MAEESQGIKL FGAMIRLNSE EVKKGEKGRE YKREEKRTEK IIPCPRCKSM ETKFCYFNNY 60 NVNQPRHFCK SCQRYWTAGG ALRNVAVGAG RRKGKPPCHD ENKFEIGSRL VSEEVHNDFR 120 QIFPAAKRRR TPSGGCLSVS CSSYLICTFS PAAKRRKILM HSCT* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang03g06820.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 1e-166 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007148051.1 | 2e-94 | hypothetical protein PHAVU_006G176400g | ||||
Swissprot | O22967 | 2e-43 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A0L9VF52 | 1e-114 | A0A0L9VF52_PHAAN; Uncharacterized protein | ||||
STRING | XP_007148051.1 | 8e-94 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29160.1 | 4e-40 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|