PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G29160.1

Common Name

COG1, DOF1.5, F28N24.35

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

Dof

Protein Properties

Length: 175aa MW: 19423 Da PI: 9.582

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G29160.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	124.6	3.3e-39	58	116	2	60
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k AT1G29160.1 58 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKSKP 116 68999***************************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	3.0E-30	57	115	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	4.4E-32	60	115	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.425	62	116	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	64	100	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010214	Biological Process	seed coat development
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046872	Molecular Function	metal ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 175 aa Download sequence Send to blast
MATQDSQGIK LFGKTITFNA NITQTIKKEE QQQQQQPELQ ATTAVRSPSS DLTAEKRPDK 60 IIPCPRCKSM ETKFCYFNNY NVNQPRHFCK GCQRYWTAGG ALRNVPVGAG RRKSKPPGRV 120 GGFAELLGAA TGAVDQVELD ALLVEEWRAA TASHGGFRHD FPVKRLRCYT DGQSC

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.64845	0.0	flower

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	260887_at	0.0
Expression Atlas	AT1G29160	-
AtGenExpress	AT1G29160	-
ATTED-II	AT1G29160	-

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269\|PubMed:19619493}.

Function -- GeneRIF ? help Back to Top
The role of At1g29160 in light perception and seed tolerance to deterioration [PMID: 27227784]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00166	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G29160.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G29160

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC021043	0.0	AC021043.4 Arabidopsis thaliana chromosome I BAC F28N24 genomic sequence, complete sequence.
GenBank	BT029990	0.0	BT029990.1 Arabidopsis thaliana At1g29160 mRNA, complete cds.
GenBank	CP002684	0.0	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_174211.1	1e-130	Dof-type zinc finger DNA-binding family protein
Swissprot	P68350	1e-131	DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBL	A0A384LMD4	1e-129	A0A384LMD4_ARATH; Uncharacterized protein
TrEMBL	C0SUY0	1e-129	C0SUY0_ARATH; Uncharacterized protein At1g29160 (Fragment)
STRING	AT1G29160.1	1e-130	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2809	26	69
Representative plant	OGRP38	17	445

Link Out ? help Back to Top
Phytozome	AT1G29160.1
Entrez Gene	839790
iHOP	AT1G29160
wikigenes	AT1G29160

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yanagisawa S The Dof family of plant transcription factors. Trends Plant Sci., 2002. 7(12): p. 555-60 [PMID:12475498] Park DH, et al. The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling. Plant J., 2003. 34(2): p. 161-71 [PMID:12694592] Lijavetzky D,Carbonero P,Vicente-Carbajosa J Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families. BMC Evol. Biol., 2003. 3: p. 17 [PMID:12877745] Guan Y,Nothnagel EA Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] Contento AL,Kim SJ,Bassham DC Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation. Plant Physiol., 2004. 135(4): p. 2330-47 [PMID:15310832] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Nakano T, et al. Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana. J. Plant Res., 2006. 119(4): p. 407-13 [PMID:16820983] Fornara F, et al. Arabidopsis DOF transcription factors act redundantly to reduce CONSTANS expression and are essential for a photoperiodic flowering response. Dev. Cell, 2009. 17(1): p. 75-86 [PMID:19619493] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]