![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang01g19410.4 | ||||||||
Common Name | LR48_Vigan01g330800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 137aa MW: 15237.3 Da PI: 11.3169 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51 | 3.4e-16 | 30 | 70 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++Tt Ed ++++a+ +lG++ W++Iar ++ gRt++ +k++w+ Vang01g19410.4 30 PFTTREDAIILHAHDRLGNK-WAAIARLLP-GRTDNAVKNHWN 70 89******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.476 | 1 | 22 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.33E-24 | 2 | 77 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.2E-10 | 2 | 35 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.956 | 23 | 77 | IPR017930 | Myb domain |
SMART | SM00717 | 5.5E-13 | 27 | 75 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-13 | 30 | 70 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.38E-10 | 30 | 73 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-18 | 36 | 74 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
LISLHVKGRS GKSCRLRWCN QLSPTVEHRP FTTREDAIIL HAHDRLGNKW AAIARLLPGR 60 TDNAVKNHWN ATLKRRASQR RRFGDDPLTA LTLAPPGSGG GGWTGGFRDV VAREVREYVS 120 FSFSDKLGSN EKLSKY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-29 | 1 | 78 | 32 | 109 | B-MYB |
1gv2_A | 3e-29 | 1 | 77 | 29 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang01g19410.4 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015036 | 0.0 | AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017433979.1 | 8e-97 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | O23160 | 9e-35 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A0L9TTL0 | 2e-95 | A0A0L9TTL0_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3RQ43 | 2e-95 | A0A0S3RQ43_PHAAN; Uncharacterized protein | ||||
STRING | GLYMA17G36370.2 | 5e-65 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G23290.1 | 2e-37 | myb domain protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|