![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G23290.1 | ||||||||
Common Name | AtMYB70, MYB70 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 309aa MW: 33229 Da PI: 5.7661 | ||||||||
Description | myb domain protein 70 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.7 | 1.5e-19 | 13 | 58 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd+ll +v+++G+++W++I++ ++ gR++k+c++rw + AT2G23290.1 13 KGPWSPEEDDLLQSLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 58 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 50.5 | 4.7e-16 | 68 | 109 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +T+eEd+ ++ a++++G++ W+tIar ++ gRt++ +k++w++ AT2G23290.1 68 FTAEEDDTIILAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 109 8******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.339 | 8 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.96E-31 | 10 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.4E-17 | 12 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-19 | 13 | 58 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-26 | 14 | 66 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.90E-16 | 15 | 57 | No hit | No description |
SMART | SM00717 | 4.3E-13 | 64 | 112 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.064 | 65 | 114 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-21 | 67 | 113 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.82E-11 | 68 | 110 | No hit | No description |
Pfam | PF00249 | 1.4E-13 | 68 | 109 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025195 | anatomy | pollen tube cell | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 309 aa Download sequence Send to blast |
MSGSTRKEMD RIKGPWSPEE DDLLQSLVQK HGPRNWSLIS KSIPGRSGKS CRLRWCNQLS 60 PEVEHRGFTA EEDDTIILAH ARFGNKWATI ARLLNGRTDN AIKNHWNSTL KRKCSGGGGG 120 GEEGQSCDFG GNGGYDGNLT DEKPLKRRAS GGGGVVVVTA LSPTGSDVSE QSQSSGSVLP 180 VSSSCHVFKP TARAGGVVIE SSSPEEEEKD PMTCLRLSLP WVNESTTPPE LFPVKREEEE 240 EKEREISGLG GDFMTVVQEM IKTEVRSYMA DLQLGNGGGA GGGASSCMVQ GTNGRNVGFR 300 EFIGLGRIE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-40 | 12 | 114 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 2e-40 | 12 | 114 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 2e-40 | 12 | 114 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30682029 | 0.0 | ||||
Genevisible | 245084_at | 0.0 | ||||
Expression Atlas | AT2G23290 | - | ||||
AtGenExpress | AT2G23290 | - | ||||
ATTED-II | AT2G23290 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Member of the R2R3 factor gene family. | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00274 | DAP | 27203113 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G23290.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT2G38300, AT5G11270 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G23290 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC002391 | 0.0 | AC002391.3 Arabidopsis thaliana chromosome 2 clone T20D16 map CIC06C07, complete sequence. | |||
GenBank | AK117263 | 0.0 | AK117263.1 Arabidopsis thaliana At2g23290 mRNA for putative MYB family transcription factor, complete cds, clone: RAFL16-81-L23. | |||
GenBank | AY519574 | 0.0 | AY519574.1 Arabidopsis thaliana MYB transcription factor (At2g23290) mRNA, complete cds. | |||
GenBank | BT008343 | 0.0 | BT008343.1 Arabidopsis thaliana At2g23280 mRNA, complete cds. | |||
GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_179910.1 | 0.0 | myb domain protein 70 | ||||
Swissprot | O23160 | 1e-131 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | O22179 | 0.0 | O22179_ARATH; At2g23280 | ||||
STRING | AT2G23290.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM677 | 28 | 135 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G23290.1 |
Entrez Gene | 816861 |
iHOP | AT2G23290 |
wikigenes | AT2G23290 |