PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AS_F568FCBF1.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family M-type_MADS
Protein Properties Length: 97aa    MW: 11051.7 Da    PI: 7.901
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AS_F568FCBF1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.61.1e-25147450
                           -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                 SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                           e+ + rqv fskRr g++KKA+ELSvLCdaeva+++fs+ g+lye+ 
  Traes_7AS_F568FCBF1.1  1 EDRTSRQVRFSKRRSGLFKKAFELSVLCDAEVALVVFSPAGRLYEFV 47
                           68899*****************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-22149IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.231150IPR002100Transcription factor, MADS-box
PfamPF003194.0E-25146IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-24165IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-171227IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-172748IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
EDRTSRQVRF SKRRSGLFKK AFELSVLCDA EVALVVFSPA GRLYEFVSSD TSVEQIFGRC  60
KDIPDTIIDD LNIAARDSRG YCNIQVRNMY VCVYMLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-152501361Myocyte-specific enhancer factor 2B
1tqe_Q4e-152501361Myocyte-specific enhancer factor 2B
1tqe_R4e-152501361Myocyte-specific enhancer factor 2B
1tqe_S4e-152501361Myocyte-specific enhancer factor 2B
6c9l_A4e-152501361Myocyte-specific enhancer factor 2B
6c9l_B4e-152501361Myocyte-specific enhancer factor 2B
6c9l_C4e-152501361Myocyte-specific enhancer factor 2B
6c9l_D4e-152501361Myocyte-specific enhancer factor 2B
6c9l_E4e-152501361Myocyte-specific enhancer factor 2B
6c9l_F4e-152501361Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
UniProtProbable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}.
UniProtTranscriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:24121311}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020181042.17e-55MADS-box transcription factor 51-like
SwissprotA2Z9Q73e-21MAD56_ORYSI; MADS-box transcription factor 56
SwissprotP0C5B23e-21MAD56_ORYSJ; MADS-box transcription factor 56
SwissprotQ388383e-21AGL14_ARATH; Agamous-like MADS-box protein AGL14
SwissprotQ9XJ611e-21MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBLA0A453RMX55e-63A0A453RMX5_AEGTS; Uncharacterized protein
STRINGTraes_7AS_F568FCBF1.13e-65(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.11e-23AGAMOUS-like 14
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  4. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  5. Kim SL,Lee S,Kim HJ,Nam HG,An G
    OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a.
    Plant Physiol., 2007. 145(4): p. 1484-94
    [PMID:17951465]
  6. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  7. Bai Z, et al.
    The impact and origin of copy number variations in the Oryza species.
    BMC Genomics, 2016. 17: p. 261
    [PMID:27025496]
  8. Shibaya T, et al.
    Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice.
    Plant Cell Physiol., 2016. 57(9): p. 1828-38
    [PMID:27318280]
  9. Han Z,Zhang B,Zhao H,Ayaad M,Xing Y
    Genome-Wide Association Studies Reveal that Diverse Heading Date Genes Respond to Short and Long Day Lengths between Indica and Japonica Rice.
    Front Plant Sci, 2016. 7: p. 1270
    [PMID:27621738]
  10. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]