PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G11880.1
Common NameAGL14, T26M18.90, XAL2
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 221aa    MW: 25492.1 Da    PI: 9.5903
Description AGAMOUS-like 14
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G11880.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.89e-31959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss
  AT4G11880.1  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS 59
                 79***********************************************96 PP
2K-box75.21.9e-2580172799
        K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                  +++ + ++++++ e   L ++ie L+ + R+++Ge+L+  s++eLqqLe+qL++sl kiR+kK++ll+e++e+l++ke++l  enk+L +k e
  AT4G11880.1  80 NHKRNDNSQQSKDETYGLARKIEHLEISTRKMMGEGLDASSIEELQQLENQLDRSLMKIRAKKYQLLREETEKLKEKERNLIAENKMLMEKCE 172
                  3467788999*******************************************************************************9976 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.071161IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-32374IPR002100Transcription factor, MADS-box
CDDcd002656.51E-41372No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.6E-2484172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.77287177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010082Biological Processregulation of root meristem growth
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:2000012Biological Processregulation of auxin polar transport
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFSSS  60
SSIPKTVERY QKRIQDLGSN HKRNDNSQQS KDETYGLARK IEHLEISTRK MMGEGLDASS  120
IEELQQLENQ LDRSLMKIRA KKYQLLREET EKLKEKERNL IAENKMLMEK CEMQGRGIIG  180
RISSSSSTSE LDIDDNEMEV VTDLFIGPPE TRHFKKFPPS N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-16160160MEF2C
5f28_B2e-16160160MEF2C
5f28_C2e-16160160MEF2C
5f28_D2e-16160160MEF2C
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.429920.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341864420.0
Genevisible254896_at0.0
Expression AtlasAT4G11880-
AtGenExpressAT4G11880-
ATTED-IIAT4G11880-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During floral transition, expressed very early at the flanks of the inflorescence meristem in the anlagens upon the transition to flowering Subsequently, expression levels increase in the first and second stages of the floral meristem and at stage 3, expression is restricted to the L1 and L2 layers. Later on, expressed in the gynoecium and stamen primordia at stage 6. {ECO:0000269|PubMed:25636918}.
UniprotTISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). Expressed in lateral root cap, root epidermis, root endodermis, columella of the root meristematic region, the vascular cylinder in differentiated zones of the primary root and in emerged lateral root primordia (PubMed:24121311). Expressed in pollen (PubMed:12949148). {ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:24121311, ECO:0000269|PubMed:7549482}.
Functional Description ? help Back to Top
Source Description
TAIRAGL12, AGL14, and AGL17 are all preferentially expressed in root tissues and therefore represent the only characterized MADS box genes expressed in roots.
UniProtTranscriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}.
Function -- GeneRIF ? help Back to Top
  1. The MADS transcription factor XAL2/AGL14 modulates auxin transport during Arabidopsis root development by regulating PIN expression.
    [PMID: 24121311]
  2. XAANTAL2 (XAL2/AGL14) is necessary and sufficient to induce flowering, and its regulation is important in floral meristem maintenance and determinacy.
    [PMID: 25636918]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G11880.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:24121311}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G24540, AT5G60910
IntActSearch Q38838
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Retarded root growth, and altered root meristem size and stem-cell patterning (PubMed:24121311). Late flowering phenotype (PubMed:25636918). {ECO:0000269|PubMed:24121311, ECO:0000269|PubMed:25636918}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G11880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2304640.0AK230464.1 Arabidopsis thaliana mRNA for MADS-box protein AGL14, complete cds, clone: RAFL26-03-G06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001319907.11e-161AGAMOUS-like 14
RefseqNP_192925.11e-161AGAMOUS-like 14
SwissprotQ388381e-162AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLR0GXA61e-136R0GXA6_9BRAS; Uncharacterized protein
STRINGAT4G11880.11e-161(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG
    Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana.
    Planta, 2005. 222(4): p. 730-42
    [PMID:16021502]
  8. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  9. Cui H,Benfey PN
    Interplay between SCARECROW, GA and LIKE HETEROCHROMATIN PROTEIN 1 in ground tissue patterning in the Arabidopsis root.
    Plant J., 2009. 58(6): p. 1016-27
    [PMID:19228333]
  10. Garay-Arroyo A, et al.
    The MADS transcription factor XAL2/AGL14 modulates auxin transport during Arabidopsis root development by regulating PIN expression.
    EMBO J., 2013. 32(21): p. 2884-95
    [PMID:24121311]
  11. P
    XAANTAL2 (AGL14) Is an Important Component of the Complex Gene Regulatory Network that Underlies Arabidopsis Shoot Apical Meristem Transitions.
    Mol Plant, 2015. 8(5): p. 796-813
    [PMID:25636918]
  12. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]
  13. Rounsley SD,Ditta GS,Yanofsky MF
    Diverse roles for MADS box genes in Arabidopsis development.
    Plant Cell, 1995. 7(8): p. 1259-69
    [PMID:7549482]