PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4DL_66D0047A7.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 174aa MW: 19644.5 Da PI: 8.9114 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 45.1 | 2.6e-14 | 124 | 174 | 2 | 52 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaS 52 Fl+k+++++ d++++ ++sw + gnsfvv+d++ fa +Lp++Fkh nf+S Traes_4DL_66D0047A7.1 124 FLTKTFDLVADPATDGVVSWGRAGNSFVVWDPHLFAAVLLPRFFKHINFSS 174 9************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.6E-16 | 117 | 174 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.36E-14 | 120 | 174 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 2.9E-6 | 120 | 174 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.1E-9 | 124 | 147 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 7.7E-12 | 124 | 174 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.1E-9 | 162 | 174 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
TRRAAQNLPS QPPSRRARSR TRQEYLSAST AHFPAEGKQP AKDHLRCVPL CYPILWFFGF 60 FRLRQEIAGC LLARPRGGMD RVLLPVRVKE EWPPPPPEEE EELEHGGLAP RPMEGLHETG 120 PPPFLTKTFD LVADPATDGV VSWGRAGNSF VVWDPHLFAA VLLPRFFKHI NFSS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF061193 | 0.0 | KF061193.1 Triticum aestivum heat shock factor HsfA2d (HSFA2d) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020178141.1 | 2e-46 | heat stress transcription factor A-2d-like | ||||
Swissprot | Q8H7Y6 | 5e-44 | HFA2D_ORYSJ; Heat stress transcription factor A-2d | ||||
TrEMBL | A0A3B6JMP6 | 6e-62 | A0A3B6JMP6_WHEAT; Uncharacterized protein | ||||
STRING | Traes_4DL_66D0047A7.1 | 1e-124 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP121 | 37 | 394 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26150.1 | 3e-31 | heat shock transcription factor A2 |
Publications ? help Back to Top | |||
---|---|---|---|
|