PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_1DL_D5BBCA2D0.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

M-type_MADS

Protein Properties

Length: 82aa MW: 9052.54 Da PI: 10.9382

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1DL_D5BBCA2D0.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	92.4	2.2e-29	33	82	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien + rqvtfskRrng+lKKA+ELSvLCd+eva+ +fs++g+lye+s Traes_1DL_D5BBCA2D0.1 33 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDVEVALAVFSPRGRLYEFS 82 79***********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	8.7E-34	25	82	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.58E-27	25	81	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	30.305	25	82	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-29	27	47	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.94E-37	27	82	No hit	No description
Pfam	PF00319	1.6E-26	34	81	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-29	47	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-29	62	82	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 82 aa Download sequence Send to blast
PFLLLIGPSS GGEGINRAPP EAGRMVRGKT EMKRIENATS RQVTFSKRRN GLLKKAFELS 60 VLCDVEVALA VFSPRGRLYE FS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
1tqe_Q	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
1tqe_R	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
1tqe_S	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
6c9l_A	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
6c9l_B	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
6c9l_C	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
6c9l_D	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
6c9l_E	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
6c9l_F	6e-16	25	82	1	58	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269\|PubMed:24121311}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. {ECO:0000269\|PubMed:24121311}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM502862	1e-100	AM502862.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM1B (WM1B gene).
GenBank	DQ512363	1e-100	DQ512363.1 Triticum aestivum MADS-box transcription factor TaAGL7 (AGL7) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020179424.1	8e-35	agamous-like MADS-box protein AGL14
Swissprot	Q38838	2e-32	AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBL	A0A452YRS8	8e-40	A0A452YRS8_AEGTS; Uncharacterized protein
TrEMBL	A0A452YRV1	6e-39	A0A452YRV1_AEGTS; Uncharacterized protein
STRING	Traes_1DL_D5BBCA2D0.1	2e-52	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	7e-35	AGAMOUS-like 14

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128]