PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_F1D5BF5F8.2
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family M-type_MADS
Protein Properties Length: 122aa    MW: 13524.9 Da    PI: 11.2421
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_F1D5BF5F8.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.32.7e-30959151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien + rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++g+lye++s
  Traes_1BL_F1D5BF5F8.2  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGRLYEFAS 59
                           79***********************************************86 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.595161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-28361IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002655.90E-39359No hitNo description
PfamPF003192.5E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALVVFSP RGRLYEFASA  60
TRYPPPRKRQ ILNLVSLLLF EIRLLLVGSW VHGRGDDTVR PSSGLAGVCN AAVAIIGGRE  120
LL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-17168177Myocyte-specific enhancer factor 2B
1tqe_Q3e-17168177Myocyte-specific enhancer factor 2B
1tqe_R3e-17168177Myocyte-specific enhancer factor 2B
1tqe_S3e-17168177Myocyte-specific enhancer factor 2B
6c9l_A3e-17168177Myocyte-specific enhancer factor 2B
6c9l_B3e-17168177Myocyte-specific enhancer factor 2B
6c9l_C3e-17168177Myocyte-specific enhancer factor 2B
6c9l_D3e-17168177Myocyte-specific enhancer factor 2B
6c9l_E3e-17168177Myocyte-specific enhancer factor 2B
6c9l_F3e-17168177Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:24121311}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028623e-84AM502862.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM1B (WM1B gene).
GenBankDQ5123633e-84DQ512363.1 Triticum aestivum MADS-box transcription factor TaAGL7 (AGL7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001329520.11e-35AGAMOUS-like 14
RefseqNP_001329521.11e-35AGAMOUS-like 14
SwissprotQ388387e-36AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLA0A446JX691e-82A0A446JX69_TRITD; Uncharacterized protein
STRINGTraes_1BL_F1D5BF5F8.22e-83(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.13e-38AGAMOUS-like 14
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  4. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]