![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp1g22380 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 257aa MW: 30311.4 Da PI: 9.414 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.6 | 5e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+lKKA+E+SvLCdaev++i+fs++gkl+eyss Tp1g22380 9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVSLIVFSHKGKLFEYSS 59 79***********************************************96 PP | |||||||
2 | K-box | 105.5 | 6.4e-35 | 85 | 176 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 + + + +++ e+++Lk++ie L+r+qRh+lGedLes+slkeLq+LeqqL++slk+iRs+Kn+l++e++++lq+keke+qeen +L k+++e Tp1g22380 85 SHVNAQTNWSMEYSRLKAKIELLERNQRHYLGEDLESISLKELQHLEQQLDTSLKHIRSRKNQLMYESLNHLQRKEKEIQEENSMLAKQIKE 176 6677889**********************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.366 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.63E-43 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-34 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.7E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.7E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.7E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.9E-30 | 85 | 174 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.211 | 90 | 180 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 257 aa Download sequence Send to blast |
MGRGRVEMKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVSLIVFSH KGKLFEYSSE 60 SSMEKVLERY ERYSYAERQL KAPDSHVNAQ TNWSMEYSRL KAKIELLERN QRHYLGEDLE 120 SISLKELQHL EQQLDTSLKH IRSRKNQLMY ESLNHLQRKE KEIQEENSML AKQIKERESI 180 LKTHHQNQWE QQNRSHHITP QPQSQPQLNP YMITHQTSPF LNMGGLYQGE HPTAVRRNTL 240 DLTLEPIYNC NLGCFAA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 5e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 5e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 5e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1 (By similarity). {ECO:0000250}. | |||||
UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1 (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp1g22380 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY514045 | 0.0 | AY514045.1 Brassica rapa var. communis DNA binding protein (CAL) mRNA, complete cds. | |||
GenBank | AY514048 | 0.0 | AY514048.1 Brassica rapa subsp. rapa DNA binding protein (CAL) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009109914.1 | 1e-172 | PREDICTED: transcription factor CAULIFLOWER isoform X1 | ||||
Swissprot | Q6R4S3 | 1e-173 | CAL_BRARR; Transcription factor CAULIFLOWER | ||||
Swissprot | Q6R4S6 | 1e-173 | CAL_BRARC; Transcription factor CAULIFLOWER | ||||
TrEMBL | A0A397YL70 | 1e-170 | A0A397YL70_BRACM; Uncharacterized protein | ||||
TrEMBL | M4D3G7 | 1e-170 | M4D3G7_BRARP; Uncharacterized protein | ||||
STRING | Bra011021.1-P | 1e-171 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM792 | 25 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26310.1 | 1e-152 | MIKC_MADS family protein |