PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_175670_ohyt.t1
Common NameSOVF_175670
Organism
Spinacia oleracea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Dof
Protein Properties Length: 110aa    MW: 12265.9 Da    PI: 8.4941
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_175670_ohyt.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof104.27.4e-331471460
             zf-Dof 14 tntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                       ++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvP+G+grrk k 
  Sp_175670_ohyt.t1  1 METKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPIGAGRRKAKP 47
                       69******************************************986 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-21146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088423.924147IPR003851Zinc finger, Dof-type
PfamPF027012.4E-26146IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010214Biological Processseed coat development
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
METKFCYFNN YNVNQPRHFC KGCQRYWTAG GALRNVPIGA GRRKAKPLGR SGGLFGEGCL  60
LDGMNMEQFD MDGMVVDDWQ LAAAMATGGA FTHDEFQVKR RRSESTGQTC
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00166DAPTransfer from AT1G29160Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021861285.13e-79dof zinc finger protein DOF1.5-like
SwissprotP683504e-43DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLA0A0K9QID81e-77A0A0K9QID8_SPIOL; Uncharacterized protein
STRINGXP_010686204.12e-55(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.12e-45Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Bueso E, et al.
    Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration.
    Plant J., 2016. 87(6): p. 583-96
    [PMID:27227784]