![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc11g012750.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 153aa MW: 17609.1 Da PI: 6.2306 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 166.3 | 3.9e-52 | 58 | 151 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 reqdrf+Pianv+rim+++lP +akis+d+k+t+qecvsefisfvt+ea+++cq e+rkti+++d+lwa++ lGf+dy+epl+ yl++yre Solyc11g012750.1.1 58 REQDRFMPIANVIRIMRRILPPHAKISDDSKQTIQECVSEFISFVTGEANERCQCEQRKTITAEDVLWAMSRLGFDDYIEPLTFYLHRYRE 148 89***************************************************************************************** PP NF-YB 93 leg 95 ++g Solyc11g012750.1.1 149 IDG 151 987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-47 | 51 | 149 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.43E-36 | 60 | 149 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.6E-25 | 63 | 127 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.7E-16 | 91 | 109 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 94 | 110 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.7E-16 | 110 | 128 | No hit | No description |
PRINTS | PR00615 | 2.7E-16 | 129 | 147 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MANLAHIYTL LYFYRAKMDN NGGGFHGYHT FPSTPATEMR MGVPVPVHLN QDSECTIREQ 60 DRFMPIANVI RIMRRILPPH AKISDDSKQT IQECVSEFIS FVTGEANERC QCEQRKTITA 120 EDVLWAMSRL GFDDYIEPLT FYLHRYREID GA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-60 | 53 | 148 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc11g012750.1.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC236948 | 0.0 | Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLe0114E01, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004250562.3 | 1e-112 | nuclear transcription factor Y subunit B-6 | ||||
Swissprot | Q84W66 | 7e-66 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A3Q7IT82 | 3e-79 | A0A3Q7IT82_SOLLC; Uncharacterized protein | ||||
STRING | Solyc11g012750.1.1 | 1e-113 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.1 | 3e-68 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc11g012750.1.1 |