PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00026194-RA_Salv

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

M-type_MADS

Protein Properties

Length: 65aa MW: 7429.82 Da PI: 10.9484

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00026194-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.1	7.4e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr g+lKKA+ELSvLCda+va+iifs +gklye+s+ SMil_00026194-RA_Salv 9 KRIENATSRQVTFSKRRSGLLKKAFELSVLCDAQVALIIFSAKGKLYEFST 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.4E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.328	1	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-31	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.06E-29	3	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.03E-35	3	60	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.4E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
MVRGKTEMKR IENATSRQVT FSKRRSGLLK KAFELSVLCD AQVALIIFSA KGKLYEFSTS 60 RLILY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-17	1	62	1	62	MEF2C
5f28_B	2e-17	1	62	1	62	MEF2C
5f28_C	2e-17	1	62	1	62	MEF2C
5f28_D	2e-17	1	62	1	62	MEF2C
6byy_A	2e-17	1	62	1	62	MEF2 CHIMERA
6byy_B	2e-17	1	62	1	62	MEF2 CHIMERA
6byy_C	2e-17	1	62	1	62	MEF2 CHIMERA
6byy_D	2e-17	1	62	1	62	MEF2 CHIMERA
6bz1_A	2e-17	1	62	1	62	MEF2 CHIMERA
6bz1_B	2e-17	1	62	1	62	MEF2 CHIMERA
6bz1_C	2e-17	1	62	1	62	MEF2 CHIMERA
6bz1_D	2e-17	1	62	1	62	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269\|PubMed:24121311}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. {ECO:0000269\|PubMed:24121311}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011081162.1	1e-33	MADS-box protein SOC1
Swissprot	Q38838	2e-33	AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBL	A0A2G9G0J1	6e-33	A0A2G9G0J1_9LAMI; Uncharacterized protein
TrEMBL	A0A2G9GAA1	3e-33	A0A2G9GAA1_9LAMI; Uncharacterized protein
TrEMBL	M1C2V5	6e-33	M1C2V5_SOLTU; Uncharacterized protein
STRING	XP_006440498.1	6e-33	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	8e-36	AGAMOUS-like 14

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128]