![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_50977.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 131aa MW: 15618 Da PI: 9.9685 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 58 | 1.6e-18 | 1 | 59 | 4 | 57 |
-SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 4 RttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 R+++t+eql +Lee++ + r+p+a + ++++++l +++ ++V++WFqN++a++++ Rsa1.0_50977.1_g00001.1 1 RWCPTPEQLMILEEMYGSgIRTPNAVQVQQITAHLafygRIEGKNVFYWFQNHKARDRQ 59 9****************99*************************************996 PP | |||||||
2 | Wus_type_Homeobox | 114.7 | 4.6e-37 | 1 | 60 | 5 | 64 |
Wus_type_Homeobox 5 RWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 RW+PtpeQ++iLee+y sG+rtPn+ ++q+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk Rsa1.0_50977.1_g00001.1 1 RWCPTPEQLMILEEMYGSGIRTPNAVQVQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 60 9**********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 2.14E-10 | 1 | 60 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 0.00166 | 1 | 58 | No hit | No description |
PROSITE profile | PS50071 | 10.284 | 1 | 60 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 2.5E-16 | 1 | 59 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 9.6E-7 | 1 | 59 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
RWCPTPEQLM ILEEMYGSGI RTPNAVQVQQ ITAHLAFYGR IEGKNVFYWF QNHKARDRQK 60 LRKKLAKKLH QQQNHLQLQL QQIKPRPISM MSPPLNNIIE YQNPCHHHHR PYDHMSFACW 120 SQPSPICLSH E |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_50977.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013744202.1 | 6e-63 | WUSCHEL-related homeobox 3 | ||||
Swissprot | Q9SIB4 | 4e-57 | WOX3_ARATH; WUSCHEL-related homeobox 3 | ||||
TrEMBL | A0A3P6D2D9 | 1e-61 | A0A3P6D2D9_BRAOL; Uncharacterized protein | ||||
STRING | Bo4g165520.1 | 2e-61 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7480 | 26 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28610.1 | 2e-49 | WOX family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|