![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.007G140300.1 | ||||||||
Common Name | PHAVU_007G140300g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 246aa MW: 27525.9 Da PI: 8.9274 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 172.4 | 1.3e-53 | 32 | 159 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 l+pGfrFhPtdeelv +yLk+kv+gk++++ ++i+evdiy++ePwdL +++k++++ewyfFs dkky +g r nrat++gyWkatg+d Phvul.007G140300.1 32 LAPGFRFHPTDEELVIYYLKRKVSGKSFRF-DAISEVDIYRSEPWDLAdkSRLKTRDQEWYFFSALDKKYGNGGRMNRATNKGYWKATGND 121 579**************************9.99**************75348899999********************************* PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++v++ ++++vglkktLvf++grap g++t+Wvmheyrl Phvul.007G140300.1 122 RPVKH-DQRTVGLKKTLVFHSGRAPVGKRTNWVMHEYRL 159 *****.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.62E-61 | 26 | 187 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 58.18 | 32 | 186 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.6E-28 | 34 | 159 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009555 | Biological Process | pollen development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0005730 | Cellular Component | nucleolus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
MGRETVFLPA PPTTATTAVN PVAAPATPPT SLAPGFRFHP TDEELVIYYL KRKVSGKSFR 60 FDAISEVDIY RSEPWDLADK SRLKTRDQEW YFFSALDKKY GNGGRMNRAT NKGYWKATGN 120 DRPVKHDQRT VGLKKTLVFH SGRAPVGKRT NWVMHEYRLV DEELERAGTG SSQPQDAYVL 180 CRVFHKNNIG PPNGQRYAPF VEEEWNDESG MIPGAEPVYN GSVAYQPLVE GNGGVLCTEG 240 RNGVVQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 1e-49 | 31 | 188 | 19 | 170 | NAC domain-containing protein 19 |
3swm_B | 1e-49 | 31 | 188 | 19 | 170 | NAC domain-containing protein 19 |
3swm_C | 1e-49 | 31 | 188 | 19 | 170 | NAC domain-containing protein 19 |
3swm_D | 1e-49 | 31 | 188 | 19 | 170 | NAC domain-containing protein 19 |
3swp_A | 1e-49 | 31 | 188 | 19 | 170 | NAC domain-containing protein 19 |
3swp_B | 1e-49 | 31 | 188 | 19 | 170 | NAC domain-containing protein 19 |
3swp_C | 1e-49 | 31 | 188 | 19 | 170 | NAC domain-containing protein 19 |
3swp_D | 1e-49 | 31 | 188 | 19 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00612 | ChIP-seq | Transfer from AT3G10490 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.007G140300.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 1e-124 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007144247.1 | 0.0 | hypothetical protein PHAVU_007G140300g, partial | ||||
Swissprot | Q9SQX9 | 1e-104 | NAC50_ARATH; NAC domain containing protein 50 | ||||
TrEMBL | V7BID3 | 0.0 | V7BID3_PHAVU; Uncharacterized protein (Fragment) | ||||
STRING | XP_007144247.1 | 0.0 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8189 | 32 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G10490.1 | 1e-103 | NAC domain containing protein 52 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.007G140300.1 |
Entrez Gene | 18625849 |
Publications ? help Back to Top | |||
---|---|---|---|
|