PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia

Family

NAC

Protein Properties

Length: 132aa MW: 15288.5 Da PI: 10.5941

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peaxi162Scf00580g00710.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	135.5	3.6e-42	7	132	2	125
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 pGfrFhPt+eelv++yLk++++++kl+ ++vi v+iy ++Pw+Lp ++ +e+ew+f ++r++k+ + +++r+ ++g+Wkat Peaxi162Scf00580g00710.1 7 LPGFRFHPTEEELVNFYLKRSIKDNKLPDSNVIGFVNIYLHDPWELPGLARLGEREWHFLVPRNRKHGPKGKPSRTSRNGFWKAT 91 59***********************9999************8778899*************************** PP NAM 87 gkdkevlsk..kgelvglkktLvfykgrapkgektdWvmhe 125 g+d ++ s+ ++++glkktLvfy+grapkg++tdWvm+e Peaxi162Scf00580g00710.1 92 GTDSQIRSSidLKKVIGLKKTLVFYSGRAPKGSRTDWVMNE 132 ***99877888**********************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	7.45E-43	5	132	IPR003441	NAC domain
PROSITE profile	PS51005	45.073	6	132	IPR003441	NAC domain
Pfam	PF02365	5.3E-22	8	132	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 132 aa Download sequence Send to blast
MSLDEHLPGF RFHPTEEELV NFYLKRSIKD NKLPDSNVIG FVNIYLHDPW ELPGLARLGE 60 REWHFLVPRN RKHGPKGKPS RTSRNGFWKA TGTDSQIRSS IDLKKVIGLK KTLVFYSGRA 120 PKGSRTDWVM NE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	5e-38	8	132	17	137	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269\|PubMed:26834774}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269\|PubMed:26834774}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016509571.1	3e-75	PREDICTED: putative NAC domain-containing protein 94 isoform X2
Swissprot	Q10S65	3e-60	NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBL	A0A1S4D881	8e-74	A0A1S4D881_TOBAC; putative NAC domain-containing protein 94 isoform X2
STRING	XP_009606805.1	2e-74	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3531	22	48

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G17040.1	1e-60	NAC domain containing protein 36

Publications ? help Back to Top
Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]