PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pbr039897.1

Organism

Pyrus bretschneideri

Taxonomic ID

225117

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

M-type_MADS

Protein Properties

Length: 64aa MW: 7200.46 Da PI: 11.081

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr039897.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	96.7	1e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien rqvtfskRrng+lKKA+ELSvLCdaeva++ifs +gklye+ss Pbr039897.1 9 KRIENAASRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSARGKLYEFSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.2E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.258	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.11E-36	3	60	No hit	No description
PRINTS	PR00404	1.5E-31	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	9.03E-29	3	61	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.4E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 64 aa Download sequence Send to blast
MVRGKTQMKR IENAASRQVT FSKRRNGLLK KAFELSVLCD AEVALVIFSA RGKLYEFSST 60 RYV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	4e-19	1	60	1	60	MEF2C
5f28_B	4e-19	1	60	1	60	MEF2C
5f28_C	4e-19	1	60	1	60	MEF2C
5f28_D	4e-19	1	60	1	60	MEF2C
6byy_A	4e-19	1	60	1	60	MEF2 CHIMERA
6byy_B	4e-19	1	60	1	60	MEF2 CHIMERA
6byy_C	4e-19	1	60	1	60	MEF2 CHIMERA
6byy_D	4e-19	1	60	1	60	MEF2 CHIMERA
6bz1_A	4e-19	1	60	1	60	MEF2 CHIMERA
6bz1_B	4e-19	1	60	1	60	MEF2 CHIMERA
6bz1_C	4e-19	1	60	1	60	MEF2 CHIMERA
6bz1_D	4e-19	1	60	1	60	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269\|PubMed:24121311}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr039897.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. {ECO:0000269\|PubMed:24121311}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB623162	4e-97	AB623162.2 Pyrus pyrifolia var. culta PpMADS8-1 mRNA for MADS-box protein, complete cds.
GenBank	KP164003	4e-97	KP164003.1 Pyrus pyrifolia clone PpSOC1-3 SOC1 MADS-box protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001280778.1	2e-35	agamous-like MADS-box protein AGL19
Refseq	XP_007134936.1	2e-35	hypothetical protein PHAVU_010G088100g
Refseq	XP_007134937.1	2e-35	hypothetical protein PHAVU_010G088100g
Refseq	XP_009345824.1	2e-35	PREDICTED: agamous-like MADS-box protein AGL19
Refseq	XP_009345827.1	2e-35	PREDICTED: agamous-like MADS-box protein AGL19
Swissprot	Q38838	9e-34	AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBL	A0A0B0N9V8	2e-34	A0A0B0N9V8_GOSAR; Uncharacterized protein
TrEMBL	M5WTQ2	1e-34	M5WTQ2_PRUPE; Uncharacterized protein (Fragment)
STRING	EMJ10160	2e-35	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	4e-36	AGAMOUS-like 14

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128]