PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400029288 | ||||||||
Common Name | LOC102598645 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 199aa MW: 22448.2 Da PI: 6.2716 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175 | 7.8e-55 | 36 | 131 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++ lGfedyv plk+yl+ky PGSC0003DMP400029288 36 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITILGFEDYVLPLKQYLSKY 124 89*************************************************************************************** PP NF-YB 91 relegek 97 relegek PGSC0003DMP400029288 125 RELEGEK 131 ****996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.7E-51 | 30 | 143 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.3E-39 | 38 | 144 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.5E-28 | 41 | 105 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.5E-18 | 69 | 87 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 72 | 88 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.5E-18 | 88 | 106 | No hit | No description |
PRINTS | PR00615 | 1.5E-18 | 107 | 125 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MEDERRGNCP ESSTMPTSTT LSTMSIIPNN NNNNNKEQDR FLPIANVGRI MKKVIPGNGK 60 ISKDAKETVQ ECVSEFISFV TGEASDKCQR EKRKTINGDD IIWAITILGF EDYVLPLKQY 120 LSKYRELEGE KLNVPKQNQP QQHDQKPTFS YNSVYSPTGL LPQTSFVPTD QPFPLPFSPN 180 SIQSQLPKQE HVDSMGHW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 9e-44 | 36 | 126 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 9e-44 | 36 | 126 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400029288 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975524 | 0.0 | HG975524.1 Solanum lycopersicum chromosome ch12, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006355096.1 | 1e-147 | PREDICTED: nuclear transcription factor Y subunit B-7 | ||||
Swissprot | Q9SIT9 | 7e-69 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
TrEMBL | M1BE77 | 1e-145 | M1BE77_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400043176 | 1e-146 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G13570.1 | 6e-71 | nuclear factor Y, subunit B7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400029288 |
Entrez Gene | 102598645 |
Publications ? help Back to Top | |||
---|---|---|---|
|