PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G13570.1

Common Name

NFYB7, NF-YB7, T10F5.11

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NF-YB

Protein Properties

Length: 215aa MW: 24619.1 Da PI: 6.4165

Description

nuclear factor Y, subunit B7

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G13570.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	179.3	3.4e-56	35	130	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdrflPianv+rimkkvlP+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyv+plkvyl kyr++egek AT2G13570.1 35 KEQDRFLPIANVGRIMKKVLPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEDYVAPLKVYLCKYRDTEGEK 130 89*******************************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.9E-54	28	163	IPR009072	Histone-fold
SuperFamily	SSF47113	1.02E-41	37	166	IPR009072	Histone-fold
Pfam	PF00808	4.1E-28	40	104	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	2.3E-18	68	86	No hit	No description
PROSITE pattern	PS00685	0	71	87	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	2.3E-18	87	105	No hit	No description
PRINTS	PR00615	2.3E-18	106	124	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0025022	anatomy	collective leaf structure
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001016	developmental stage	L mature pollen stage
PO:0001017	developmental stage	M germinated pollen stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 215 aa Download sequence Send to blast
MTEESPEEDH GSPGVAETNP GSPSSKTNNN NNNNKEQDRF LPIANVGRIM KKVLPGNGKI 60 SKDAKETVQE CVSEFISFVT GEASDKCQRE KRKTINGDDI IWAITTLGFE DYVAPLKVYL 120 CKYRDTEGEK VNSPKQQQQR QQQQQIQQQN HHNYQFQEQD QNNNNMSCTS YISHHHPSPF 180 LPVDHQPFPN IAFSPKSLQK QFPQQHDNNI DSIHW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-44	35	125	2	92	Transcription factor HapC (Eurofung)
4g92_B	2e-44	35	125	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	263718_at	0.0
Expression Atlas	AT2G13570	-
AtGenExpress	AT2G13570	-
ATTED-II	AT2G13570	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers and green siliques. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G13570.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G12480, AT3G48590, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G07980, AT1G08970, AT1G09030, AT1G54830, AT1G56170
IntAct	Search Q9SIT9

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G13570

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC007063	0.0	AC007063.6 Arabidopsis thaliana chromosome 2 clone T10F5 map PR1, complete sequence.
GenBank	BT025276	0.0	BT025276.1 Arabidopsis thaliana At2g13570 mRNA, complete cds.
GenBank	CP002685	0.0	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBank	DQ446491	0.0	DQ446491.1 Arabidopsis thaliana clone pENTR221-At2g13570 CCAAT-box binding transcription factor (At2g13570) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_178981.1	1e-160	nuclear factor Y, subunit B7
Swissprot	Q9SIT9	1e-162	NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBL	A0A384KFW4	1e-159	A0A384KFW4_ARATH; NF-YB7
TrEMBL	A0MEK8	1e-159	A0MEK8_ARATH; Uncharacterized protein (Fragment)
TrEMBL	C0SV44	1e-159	C0SV44_ARATH; Uncharacterized protein At2g13570 (Fragment)
STRING	AT2G13570.1	1e-160	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229
Representative plant	OGRP168	17	170

Link Out ? help Back to Top
Phytozome	AT2G13570.1
Entrez Gene	815843
iHOP	AT2G13570
wikigenes	AT2G13570

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Gusmaroli G,Tonelli C,Mantovani R Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana. Gene, 2001. 264(2): p. 173-85 [PMID:11250072] Gusmaroli G,Tonelli C,Mantovani R Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits. Gene, 2002. 283(1-2): p. 41-8 [PMID:11867211] Kwong RW, et al. LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development. Plant Cell, 2003. 15(1): p. 5-18 [PMID:12509518] Wenkel S, et al. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell, 2006. 18(11): p. 2971-84 [PMID:17138697] Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Hackenberg D, et al. Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y. Mol Plant, 2012. 5(4): p. 876-88 [PMID:22199235] Calvenzani V, et al. Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits. PLoS ONE, 2012. 7(8): p. e42902 [PMID:22912760] Sato H, et al. Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits. Plant Cell, 2014. 26(12): p. 4954-73 [PMID:25490919] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]