PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NAC

Protein Properties

Length: 168aa MW: 19754.8 Da PI: 10.2553

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400015242	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	148.6	3.1e-46	9	135	3	128
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 pGfrFhPt+eel+++yLk+ ++++k++ ++i ++iy ++Pw+Lp +++ +e+ewyfF++ ++k+ + r+nr+t+sg+Wkatg+d++ PGSC0003DMP400015242 9 PGFRFHPTEEELINFYLKRIINDDKIDS-NTIGFLNIYLYDPWELPGMARIGEREWYFFVPINRKHGPKGRPNRTTRSGFWKATGSDRQ 96 9************************9.88***********8888999******************************** PP NAM 92 vlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 + s+ ++++glkktLvfy grapkg++tdWvm+eyrl PGSC0003DMP400015242 97 IRSSlePKKAIGLKKTLVFYGGRAPKGTRTDWVMNEYRL 135 99888889***************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	48.044	7	159	IPR003441	NAC domain
SuperFamily	SSF101941	1.57E-50	8	141	IPR003441	NAC domain
Pfam	PF02365	9.4E-26	9	135	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 168 aa Download sequence Send to blast
MSLTELELPG FRFHPTEEEL INFYLKRIIN DDKIDSNTIG FLNIYLYDPW ELPGMARIGE 60 REWYFFVPIN RKHGPKGRPN RTTRSGFWKA TGSDRQIRSS LEPKKAIGLK KTLVFYGGRA 120 PKGTRTDWVM NEYRLPHGHK VLQFIMQTHN AKLYRYFVSS CIYLFIF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-40	4	135	11	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269\|PubMed:26834774}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400015242

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269\|PubMed:26834774}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975441	1e-126	HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBank	HG975514	1e-126	HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015160762.1	1e-103	PREDICTED: NAC transcription factor 25-like isoform X1
Swissprot	Q10S65	2e-68	NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBL	M1AGL5	1e-121	M1AGL5_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400022365	1e-101	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G17040.1	3e-67	NAC domain containing protein 36

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400015242

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]