| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 99 | 1.8e-31 | 145 | 195 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
OMERI06G13620.1 145 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 195
79***********************************************96 PP
|
| 2 | K-box | 75.5 | 1.5e-25 | 206 | 279 | 26 | 100 |
K-box 26 keienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
k+++++++ R+llGedL+sL +keL++Le+qL++slk++R++++++l++q+ elq+ke++++e+n++Lr+klee
OMERI06G13620.1 206 KQLSKIEK-VRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEE 279
34455555.5**************************************************************987 PP
|
| Protein Features
? help Back to Top |
 |
| Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
| PROSITE profile | PS50066 | 33.389 | 137 | 197 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.3E-41 | 137 | 196 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.33E-40 | 138 | 201 | No hit | No description |
| SuperFamily | SSF55455 | 1.7E-30 | 138 | 215 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 139 | 193 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-32 | 139 | 159 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.0E-26 | 146 | 193 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-32 | 159 | 174 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-32 | 174 | 195 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 11.71 | 191 | 283 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 1.4E-18 | 213 | 277 | IPR002487 | Transcription factor, K-box |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Shitsukawa N, et al.
Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat.
Plant Cell, 2007. 19(6): p. 1723-37
[PMID:17586655] - Bai X,Wang Q,Chu C
Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter.
Transgenic Res., 2008. 17(6): p. 1035-43
[PMID:18437520] - Qu L, et al.
Expression pattern and functional analysis of a MADS-box gene M79 from rice.
Sci. China, C, Life Sci., 2001. 44(2): p. 161-9
[PMID:18726433] - Cui R, et al.
Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa).
Plant J., 2010. 61(5): p. 767-81
[PMID:20003164] - Li H, et al.
The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice.
Cell Res., 2010. 20(3): p. 299-313
[PMID:20038961] - Seok HY, et al.
Rice ternary MADS protein complexes containing class B MADS heterodimer.
Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
[PMID:20888318] - Tang X, et al.
Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis.
Plant Physiol., 2010. 154(4): p. 1855-70
[PMID:20959420] - Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY
High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice.
Theor. Appl. Genet., 2011. 122(8): p. 1489-96
[PMID:21327937] - Li H, et al.
Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
Plant Cell, 2011. 23(7): p. 2536-52
[PMID:21784949] - Yoshida H
Is the lodicule a petal: molecular evidence?
Plant Sci., 2012. 184: p. 121-8
[PMID:22284716] - Duan Y, et al.
Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.).
Plant Mol. Biol., 2012. 80(4-5): p. 429-42
[PMID:22933119] - Wong CE,Singh MB,Bhalla PL
Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean.
BMC Plant Biol., 2013. 13: p. 105
[PMID:23870482] - Hu Z,Ding X,Hu S,Sun Y,Xia L
Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice.
Biotechnol. Lett., 2013. 35(12): p. 2177-83
[PMID:23974493] - Bai X, et al.
Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
Sci Rep, 2016. 6: p. 19022
[PMID:26744119] - Dreni L,Zhang D
Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes.
J. Exp. Bot., 2016. 67(6): p. 1625-38
[PMID:26956504]
|
