PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G03710.1

Common Name

AGL3, F19B11.16, SEP4

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 258aa MW: 29573.3 Da PI: 9.2511

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G03710.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	96.7	9.9e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdae+a++ifs++gklye++s AT2G03710.1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCS 59 79***********************************************96 PP
2	K-box	87.5	2.7e-29	82	173	8	99
K-box 8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++++++ + +q++ kLk+++e Lq++qRhllGe+L++++++eL++Le+q++ sl++iRs+K + +l+q+++l+ ke++l e+n++Lr+kle AT2G03710.1 82 NQSAKDLQDKYQDYLKLKSRVEILQHSQRHLLGEELSEMDVNELEHLERQVDASLRQIRSTKARSMLDQLSDLKTKEEMLLETNRDLRRKLE 173 36788999**********************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.0E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.137	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	8.53E-43	2	77	No hit	No description
SuperFamily	SSF55455	3.79E-32	2	78	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.8E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-32	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	6.7E-24	86	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.575	88	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010076	Biological Process	maintenance of floral meristem identity
GO:0048440	Biological Process	carpel development
GO:0048441	Biological Process	petal development
GO:0048442	Biological Process	sepal development
GO:0048443	Biological Process	stamen development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 258 aa Download sequence Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEIALLIFSN RGKLYEFCSS 60 PSGMARTVDK YRKHSYATMD PNQSAKDLQD KYQDYLKLKS RVEILQHSQR HLLGEELSEM 120 DVNELEHLER QVDASLRQIR STKARSMLDQ LSDLKTKEEM LLETNRDLRR KLEDSDAALT 180 QSFWGSSAAE QQQQHQQQQQ GMSSYQSNPP IQEAGFFKPL QGNVALQMSS HYNHNPANAT 240 NSATTSQNVN GFFPGWMV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4ox0_A	4e-23	93	174	22	103	Developmental protein SEPALLATA 3
4ox0_B	4e-23	93	174	22	103	Developmental protein SEPALLATA 3
4ox0_C	4e-23	93	174	22	103	Developmental protein SEPALLATA 3
4ox0_D	4e-23	93	174	22	103	Developmental protein SEPALLATA 3
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.10200	0.0	bud\| leaf\| vegetative tissue

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	264041_at	0.0
Expression Atlas	AT2G03710	-
AtGenExpress	AT2G03710	-
ATTED-II	AT2G03710	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in aerial vegetative organs and flowers, but not in roots (PubMed:7632923). Expressed in flower primordia (PubMed:15530395). {ECO:0000269\|PubMed:15530395, ECO:0000269\|PubMed:7632923}.

Functional Description ? help Back to Top
Source	Description
TAIR	This gene belongs to the family of SEP genes. It is involved in the development of sepals, petals, stamens and carpels. Additionally, it plays a central role in the determination of flower meristem and organ identity.
UniProt	Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269\|PubMed:15530395, ECO:0000269\|PubMed:25183521, ECO:0000269\|PubMed:7632923}.

Function -- GeneRIF ? help Back to Top
SEP4 contributes to the development of petals, stamens, carpels, sepals and plays an important role in meristem identity. [SEPALLATA4] [SEP4] [PMID: 15530395]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00030	SELEX	16381825	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G03710.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT2G03710, AT2G45660, AT5G23260, AT5G60910, AT1G31630, AT1G31640, AT1G46408, AT1G48150, AT1G69120, AT1G77980
IntAct	Search P29383

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G03710

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	ATU81369	0.0	U81369.1 Arabidopsis thaliana MADS box protein (AGL3) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_178466.1	0.0	K-box region and MADS-box transcription factor family protein
Swissprot	P29383	0.0	AGL3_ARATH; Agamous-like MADS-box protein AGL3
TrEMBL	A0A178VVE1	0.0	A0A178VVE1_ARATH; SEP4
STRING	AT2G03710.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7135	24	40
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT2G03710.1
Entrez Gene	814898
iHOP	AT2G03710
wikigenes	AT2G03710

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Gong W, et al. Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes. Plant Physiol., 2004. 135(2): p. 773-82 [PMID:15208423] Ditta G,Pinyopich A,Robles P,Pelaz S,Yanofsky MF The SEP4 gene of Arabidopsis thaliana functions in floral organ and meristem identity. Curr. Biol., 2004. 14(21): p. 1935-40 [PMID:15530395] Wang XJ,Cao XL,Hong Y Isolation and characterization of flower-specific transcripts in Acacia mangium. Tree Physiol., 2005. 25(2): p. 167-78 [PMID:15574398] Albert VA, et al. Floral gene resources from basal angiosperms for comparative genomics research. BMC Plant Biol., 2005. 5: p. 5 [PMID:15799777] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Kaufmann K,Anfang N,Saedler H,Theissen G Mutant analysis, protein-protein interactions and subcellular localization of the Arabidopsis B sister (ABS) protein. Mol. Genet. Genomics, 2005. 274(2): p. 103-18 [PMID:16080001] Malcomber ST,Kellogg EA SEPALLATA gene diversification: brave new whorls. Trends Plant Sci., 2005. 10(9): p. 427-35 [PMID:16099195] Ma H,Yanofsky MF,Meyerowitz EM AGL1-AGL6, an Arabidopsis gene family with similarity to floral homeotic and transcription factor genes. Genes Dev., 1991. 5(3): p. 484-95 [PMID:1672119] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Matias-Hernandez L, et al. VERDANDI is a direct target of the MADS domain ovule identity complex and affects embryo sac differentiation in Arabidopsis. Plant Cell, 2010. 22(6): p. 1702-15 [PMID:20581305] Liu C, et al. A conserved genetic pathway determines inflorescence architecture in Arabidopsis and rice. Dev. Cell, 2013. 24(6): p. 612-22 [PMID:23537632] Jetha K,Thei Arabidopsis SEPALLATA proteins differ in cooperative DNA-binding during the formation of floral quartet-like complexes. Nucleic Acids Res., 2014. 42(17): p. 10927-42 [PMID:25183521] Maejima K, et al. Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen. Plant Signal Behav, 2015. 10(8): p. e1042635 [PMID:26179462] Huang H,Tudor M,Weiss CA,Hu Y,Ma H The Arabidopsis MADS-box gene AGL3 is widely expressed and encodes a sequence-specific DNA-binding protein. Plant Mol. Biol., 1995. 28(3): p. 549-67 [PMID:7632923]