![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf06551g00018.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 71aa MW: 8336.7 Da PI: 11.2903 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 82.2 | 3.4e-26 | 21 | 67 | 4 | 50 |
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 ++ +nrqvtfskRrngilKK +ELSvLCd++va+i+fs++g+l ys Niben101Scf06551g00018.1 21 NSLTNRQVTFSKRRNGILKKIYELSVLCDVDVAIIMFSPSGRLTHYS 67 6779****************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00404 | 2.2E-18 | 12 | 32 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.2E-20 | 18 | 69 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 21.67 | 18 | 70 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 9.94E-22 | 21 | 68 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.0E-24 | 24 | 66 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-18 | 32 | 47 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-18 | 47 | 68 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 71 aa Download sequence Send to blast |
MISFPPFVFG NQYFHNPKNT NSLTNRQVTF SKRRNGILKK IYELSVLCDV DVAIIMFSPS 60 GRLTHYSRKR R |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015160390.1 | 7e-28 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
Refseq | XP_019254059.1 | 2e-26 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
Swissprot | Q9LM46 | 7e-19 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
TrEMBL | A0A0V0GZA3 | 3e-27 | A0A0V0GZA3_SOLCH; Putative MADS-box transcription factor 58-like (Fragment) | ||||
STRING | Solyc05g051830.2.1 | 3e-25 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA13070 | 14 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22130.1 | 3e-21 | AGAMOUS-like 104 |
Publications ? help Back to Top | |||
---|---|---|---|
|