![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G22130.1 | ||||||||
Common Name | AGL104, F2E2.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 335aa MW: 38278.7 Da PI: 4.6411 | ||||||||
Description | AGAMOUS-like 104 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.3 | 7.5e-27 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++++l +s AT1G22130.1 9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSDRLSLFS 58 79******************************************998776 PP | |||||||
2 | K-box | 19.2 | 5.2e-08 | 122 | 191 | 10 | 79 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqiee 79 +++ e+l++e+ +L++++++ ++e+R++ + + +++e + e+qL + l+++ +++++l+ ++++ AT1G22130.1 122 INSDVEELEHEVCRLQQQLQMAEEELRRYEPDPIRFTTMEEYEVSEKQLLDTLTHVVQRRDHLMSNHLSS 191 5678999**********************************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.973 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.0E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.99E-34 | 2 | 75 | No hit | No description |
SuperFamily | SSF55455 | 7.72E-29 | 2 | 82 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.9E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-24 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.9E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.9E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025195 | anatomy | pollen tube cell | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001016 | developmental stage | L mature pollen stage | ||||
PO:0001017 | developmental stage | M germinated pollen stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 335 aa Download sequence Send to blast |
MGRVKLEIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SDRLSLFSGK 60 TRIEDVFSRF INLPKQERES ALYFPDQNRR PDIQNKECLL RILQQLKTEN DIALQVTNPA 120 AINSDVEELE HEVCRLQQQL QMAEEELRRY EPDPIRFTTM EEYEVSEKQL LDTLTHVVQR 180 RDHLMSNHLS SYEASTMQPN IGGPFVNDVV EGWLPENGTN QTHLFDASAH SNQLRELSSA 240 MYEPLLQGSS SSSNQNNMSE CHVTNHNGEM FPEWAQAYSS SALFASMQQQ HEGVGPSIEE 300 MMPAQQSDIP GVTAETQVDH EVSDYETKVP QLSSQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 1e-15 | 2 | 54 | 1 | 53 | Myocyte-specific enhancer factor 2A |
3mu6_B | 1e-15 | 2 | 54 | 1 | 53 | Myocyte-specific enhancer factor 2A |
3mu6_C | 1e-15 | 2 | 54 | 1 | 53 | Myocyte-specific enhancer factor 2A |
3mu6_D | 1e-15 | 2 | 54 | 1 | 53 | Myocyte-specific enhancer factor 2A |
6bz1_A | 3e-15 | 1 | 90 | 1 | 91 | MEF2 CHIMERA |
6bz1_B | 3e-15 | 1 | 90 | 1 | 91 | MEF2 CHIMERA |
6bz1_C | 3e-15 | 1 | 90 | 1 | 91 | MEF2 CHIMERA |
6bz1_D | 3e-15 | 1 | 90 | 1 | 91 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 255952_at | 0.0 | ||||
Expression Atlas | AT1G22130 | - | ||||
AtGenExpress | AT1G22130 | - | ||||
ATTED-II | AT1G22130 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a member of the MIKC (MADS box, Keratin binding domain, and C terminal domain containing )family of transcriptional regulators. AGL104 is expressed in pollen.It forms heterodimers with other MICK family members (AGL65 and AGL30). Involved in late stages of pollen development and pollen tube growth. | |||||
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G22130.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT1G46408 |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. Pollen grains from the double mutant agl66 and agl104 have severely reduced viability, delayed germination and aberrant pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G22130 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ056457 | 0.0 | DQ056457.1 Arabidopsis thaliana MADS-box family protein (At1g22130) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_173632.1 | 0.0 | AGAMOUS-like 104 | ||||
Swissprot | Q9LM46 | 0.0 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
TrEMBL | A0A178W4Y8 | 0.0 | A0A178W4Y8_ARATH; AGL104 | ||||
STRING | AT1G22130.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2179 | 23 | 65 | Representative plant | OGRP16 | 17 | 761 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G22130.1 |
Entrez Gene | 838818 |
iHOP | AT1G22130 |
wikigenes | AT1G22130 |