Signature Domain? help Back to Top |
![Signature Domain](draw_signature_domain.php?sp=Nbe&pid=Niben101Ctg06296g00002.1) |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | HSF_DNA-bind | 80.3 | 3e-25 | 63 | 121 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Flkk++e+++d++++++isws+++ sfvv+d+++f+ ++Lpk+Fkh+nf+SF+RQLn+Y
Niben101Ctg06296g00002.1 63 FLKKTFEMVDDPNTDSIISWSNTKASFVVWDPHKFSIDILPKHFKHNNFSSFIRQLNTY 121
9********************999**********************************9 PP
|
Publications
? help Back to Top |
- Liu HC,Charng YY
Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development. Plant Physiol., 2013. 163(1): p. 276-90 [PMID:23832625] - Jung HS, et al.
Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9 [PMID:23918368] - Chauhan H,Khurana N,Agarwal P,Khurana JP,Khurana P
A seed preferential heat shock transcription factor from wheat provides abiotic stress tolerance and yield enhancement in transgenic Arabidopsis under heat stress environment. PLoS ONE, 2013. 8(11): p. e79577 [PMID:24265778] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Weng M, et al.
Histone chaperone ASF1 is involved in gene transcription activation in response to heat stress in Arabidopsis thaliana. Plant Cell Environ., 2014. 37(9): p. 2128-38 [PMID:24548003] - Jang YH, et al.
A homolog of splicing factor SF1 is essential for development and is involved in the alternative splicing of pre-mRNA in Arabidopsis thaliana. Plant J., 2014. 78(4): p. 591-603 [PMID:24580679] - Stief A, et al.
Arabidopsis miR156 Regulates Tolerance to Recurring Environmental Stress through SPL Transcription Factors. Plant Cell, 2014. 26(4): p. 1792-1807 [PMID:24769482] - Dobrá J, et al.
The impact of heat stress targeting on the hormonal and transcriptomic response in Arabidopsis. Plant Sci., 2015. 231: p. 52-61 [PMID:25575991] - Yamauchi Y,Kunishima M,Mizutani M,Sugimoto Y
Reactive short-chain leaf volatiles act as powerful inducers of abiotic stress-related gene expression. Sci Rep, 2015. 5: p. 8030 [PMID:25619826] - Shi H, et al.
Melatonin induces class A1 heat-shock factors (HSFA1s) and their possible involvement of thermotolerance in Arabidopsis. J. Pineal Res., 2015. 58(3): p. 335-42 [PMID:25711624] - Mueller SP,Krause DM,Mueller MJ,Fekete A
Accumulation of extra-chloroplastic triacylglycerols in Arabidopsis seedlings during heat acclimation. J. Exp. Bot., 2015. 66(15): p. 4517-26 [PMID:25977236] - Nie S,Yue H,Xing D
A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] - Nguyen AH, et al.
Loss of Arabidopsis 5'-3' Exoribonuclease AtXRN4 Function Enhances Heat Stress Tolerance of Plants Subjected to Severe Heat Stress. Plant Cell Physiol., 2015. 56(9): p. 1762-72 [PMID:26136597] - Hu Z, et al.
Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis. Plant J., 2015. 84(6): p. 1178-91 [PMID:26576681] - Lämke J,Brzezinka K,Bäurle I
HSFA2 orchestrates transcriptional dynamics after heat stress in Arabidopsis thaliana. Transcription, 2016. 7(4): p. 111-4 [PMID:27383578] - Wang X,Huang W,Liu J,Yang Z,Huang B
Molecular regulation and physiological functions of a novel FaHsfA2c cloned from tall fescue conferring plant tolerance to heat stress. Plant Biotechnol. J., 2017. 15(2): p. 237-248 [PMID:27500592] - Chen ST,He NY,Chen JH,Guo FQ
Identification of core subunits of photosystem II as action sites of HSP21, which is activated by the GUN5-mediated retrograde pathway in Arabidopsis. Plant J., 2017. 89(6): p. 1106-1118 [PMID:27943531] - Kataoka R,Takahashi M,Suzuki N
Coordination between bZIP28 and HSFA2 in the regulation of heat response signals in Arabidopsis. Plant Signal Behav, 2017. 12(11): p. e1376159 [PMID:28873003] - Wang X,Zhuang L,Shi Y,Huang B
Up-Regulation of HSFA2c and HSPs by ABA Contributing to Improved Heat Tolerance in Tall Fescue and Arabidopsis. Int J Mol Sci, 2018. [PMID:28914758] - Llamas E,Pulido P,Rodriguez-Concepcion M
Interference with plastome gene expression and Clp protease activity in Arabidopsis triggers a chloroplast unfolded protein response to restore protein homeostasis. PLoS Genet., 2017. 13(9): p. e1007022 [PMID:28937985] - Li X, et al.
Plastid Translation Elongation Factor Tu Is Prone to Heat-Induced Aggregation Despite Its Critical Role in Plant Heat Tolerance. Plant Physiol., 2018. 176(4): p. 3027-3045 [PMID:29444814]
|