PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_7199_f_9

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

TALE

Protein Properties

Length: 147aa MW: 17004.3 Da PI: 8.4659

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_7199_f_9	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	30.3	7.2e-10	72	107	20	55
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps+ ++ LA+ +gL+ +q+ +WF N+R ++ Neem_7199_f_9 72 NKWPYPSEPQKLALAAATGLDSKQINNWFINQRKRH 107 4569*****************************985 PP
2	ELK	40.7	5e-14	27	48	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK qLlrKYsg+Lg+LkqEF+ Neem_7199_f_9 27 ELKGQLLRKYSGCLGNLKQEFL 48 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03789	7.9E-11	27	48	IPR005539	ELK domain
SMART	SM01188	1.7E-7	27	48	IPR005539	ELK domain
PROSITE profile	PS51213	10.58	27	47	IPR005539	ELK domain
PROSITE profile	PS50071	12.131	47	110	IPR001356	Homeobox domain
SuperFamily	SSF46689	6.42E-19	49	123	IPR009057	Homeodomain-like
SMART	SM00389	5.0E-12	49	114	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	2.2E-26	52	112	IPR009057	Homeodomain-like
CDD	cd00086	1.86E-11	56	110	No hit	No description
Pfam	PF05920	6.9E-16	67	106	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	85	108	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 147 aa Download sequence Send to blast
MAGQSGSSEE EIDVNDQCID PLAEDGELKG QLLRKYSGCL GNLKQEFLKK KKKGKLPNEA 60 RQQLLDWWSR HNKWPYPSEP QKLALAAATG LDSKQINNWF INQRKRHWKP ADHHMQFVVM 120 DGMYPQYYME NVTGTPFSMD CTTPARF

Functional Description ? help Back to Top
Source	Description
UniProt	Required for shoot apical meristem (SAM) formation during embryogenesis. Negatively regulates ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2 or LBD6). Probably binds to the DNA sequence 5'-TGAC-3'. Binds to RNA (By similarity). {ECO:0000250\|UniProtKB:P24345, ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:11934861}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024046106.1	5e-74	homeobox protein knotted-1-like LET6
Refseq	XP_024950608.1	5e-74	homeobox protein knotted-1-like LET6
Swissprot	Q38874	4e-62	STM_ARATH; Homeobox protein SHOOT MERISTEMLESS
TrEMBL	A0A2H5QH89	9e-73	A0A2H5QH89_CITUN; Uncharacterized protein
TrEMBL	V4U4K9	8e-73	V4U4K9_9ROSI; Uncharacterized protein
STRING	XP_006469758.1	1e-73	(Citrus sinensis)
STRING	evm.model.supercontig_152.56	3e-74	(Carica papaya)
STRING	XP_006447622.1	1e-73	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6473	26	44

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G62360.1	5e-59	KNOX/ELK homeobox transcription factor

Publications ? help Back to Top
Zhang XL,Yang ZP,Zhang J,Zhang LG Ectopic expression of BraYAB1-702, a member of YABBY gene family in Chinese cabbage, causes leaf curling, inhibition of development of shoot apical meristem and flowering stage delaying in Arabidopsis thaliana. Int J Mol Sci, 2013. 14(7): p. 14872-91 [PMID:23863694] Liu C, et al. Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis. J Integr Plant Biol, 2013. 55(8): p. 682-95 [PMID:23931744] Simonini S,Kater MM Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance. J. Exp. Bot., 2014. 65(6): p. 1455-65 [PMID:24482368] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Lee JE,Lampugnani ER,Bacic A,Golz JF SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] Ckurshumova W,Berleth T Overcoming recalcitrance - Auxin response factor functions in plant regeneration. Plant Signal Behav, 2015. 10(7): p. e993293 [PMID:26098229] Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development. Plant Cell Physiol., 2015. 56(9): p. 1855-66 [PMID:26220906] Rast-Somssich MI, et al. Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta. Genes Dev., 2015. 29(22): p. 2391-404 [PMID:26588991] Landrein B, et al. Mechanical stress contributes to the expression of the STM homeobox gene in Arabidopsis shoot meristems. Elife, 2015. 4: p. e07811 [PMID:26623515] Guzmán-López JA,Abraham-Juárez MJ,Lozano-Sotomayor P,de Folter S,Simpson J Arabidopsis thaliana gonidialess A/Zuotin related factors (GlsA/ZRF) are essential for maintenance of meristem integrity. Plant Mol. Biol., 2016. 91(1-2): p. 37-51 [PMID:26826012] Shi B, et al. Two-Step Regulation of a Meristematic Cell Population Acting in Shoot Branching in Arabidopsis. PLoS Genet., 2016. 12(7): p. e1006168 [PMID:27398935] Lee HG,Choi YR,Seo PJ Increased STM expression is associated with drought tolerance in Arabidopsis. J. Plant Physiol., 2016. 201: p. 79-84 [PMID:27448723] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Singh S, et al. Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components. Sci Rep, 2017. 7: p. 42450 [PMID:28195159] Lee HG,Choi YR,Seo PJ Erratum to "Increased STM expression is associated with drought tolerance in Arabidopsis" [J. Plant Physiol. 201 (2016) 79-84]. J. Plant Physiol., 2018. 228: p. 218 [PMID:28456397] Xue T, et al. ARGONAUTE10 Inhibits In Vitro Shoot Regeneration Via Repression of miR165/166 in Arabidopsis thaliana. Plant Cell Physiol., 2017. 58(10): p. 1789-1800 [PMID:29016889] Dolzblasz A, et al. Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4. Int J Mol Sci, 2018. [PMID:29538317] Scofield S, et al. Coordination of meristem and boundary functions by transcription factors in the SHOOT MERISTEMLESS regulatory network. Development, 2018. [PMID:29650590] Liu L, et al. FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis. Cell Rep, 2018. 23(6): p. 1879-1890 [PMID:29742441] Chung Y, et al. Auxin Response Factors promote organogenesis by chromatin-mediated repression of the pluripotency gene SHOOTMERISTEMLESS. Nat Commun, 2019. 10(1): p. 886 [PMID:30792395]