PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

bZIP

Protein Properties

Length: 94aa MW: 11326.2 Da PI: 11.4359

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_28165_f_2	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	51	3.2e-16	16	67	5	56
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+ e+ ++ Neem_28165_f_2 16 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELRKKQAEMMEMQ 67 79****************************************9988887775 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	4.5E-14	12	78	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.461	14	65	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	4.5E-16	16	66	No hit	No description
CDD	cd14707	4.26E-17	16	70	No hit	No description
Pfam	PF00170	1.4E-14	16	68	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.19E-12	16	66	No hit	No description
PROSITE pattern	PS00036	0	19	34	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
LRGRKFNGNV EKVVERRQRR MIKNRESAAR SRARKQAYTM ELEAEVAKLK EENQELRKKQ 60 AEMMEMQKNQ VLEMMNMQQG SKKRCLRRTQ TGPW

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269\|PubMed:10611387}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA). {ECO:0000269\|PubMed:10611387}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006434756.1	8e-55	ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X1
Swissprot	Q6ZDF3	4e-42	TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBL	A0A067D5D2	2e-55	A0A067D5D2_CITSI; Uncharacterized protein
STRING	XP_006434756.1	3e-54	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM734	27	129

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G19290.1	5e-33	ABRE binding factor 4

Publications ? help Back to Top
Kagaya Y,Hobo T,Murata M,Ban A,Hattori T Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1. Plant Cell, 2002. 14(12): p. 3177-89 [PMID:12468735] Kobayashi Y, et al. Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors. Plant J., 2005. 44(6): p. 939-49 [PMID:16359387] Kobayashi F,Maeta E,Terashima A,Takumi S Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings. Physiol Plant, 2008. 134(1): p. 74-86 [PMID:18433415]