PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_14337_f_2

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

M-type_MADS

Protein Properties

Length: 81aa MW: 9198.79 Da PI: 10.7524

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_14337_f_2	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.4	4.6e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKAeELSvLCdaev viifs tgkl+eyss Neem_14337_f_2 9 KKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVGVIIFSATGKLFEYSS 59 68***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.562	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.6E-38	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.44E-28	1	70	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.61E-34	2	60	No hit	No description
PRINTS	PR00404	2.7E-27	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.3E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.7E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.7E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MAREKIKIKK IDNVTARQVT FSKRRRGLFK KAEELSVLCD AEVGVIIFSA TGKLFEYSSS 60 RSLLHPVLNS AEPFPSKRPY L

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-18	1	60	1	60	MEF2C
5f28_B	1e-18	1	60	1	60	MEF2C
5f28_C	1e-18	1	60	1	60	MEF2C
5f28_D	1e-18	1	60	1	60	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269\|PubMed:12451184, ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:12881501, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18466303, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18694458}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011016930.1	1e-33	PREDICTED: MADS-box protein JOINTLESS
Refseq	XP_024452024.1	1e-33	MADS-box protein JOINTLESS
Swissprot	O82794	4e-32	AGL24_ARATH; MADS-box protein AGL24
TrEMBL	A0A200QJ11	2e-33	A0A200QJ11_9MAGN; Transcription factor
STRING	POPTR_0002s10570.1	2e-34	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G24540.1	2e-34	AGAMOUS-like 24

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Lei HJ, et al. Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry. Gene, 2013. 531(2): p. 158-67 [PMID:24055423] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148] Sun LM,Zhang JZ,Hu CG Characterization and Expression Analysis of PtAGL24, a SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 (SVP/AGL24)-Type MADS-Box Gene from Trifoliate Orange (Poncirus trifoliata L. Raf.). Front Plant Sci, 2016. 7: p. 823 [PMID:27375669]