PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT4G24540.1

Common Name

AGL24, F22K18.260

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 220aa MW: 25063.7 Da PI: 8.4712

Description

AGAMOUS-like 24

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G24540.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	88.2	4.4e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr gi+KKA ELSvLCda+va+iifs tgkl+e+ss AT4G24540.1 9 KKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSS 59 68***********************************************96 PP
2	K-box	57.9	4.4e-20	93	172	20	99
K-box 20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +l++L ke+e +++R+l GedL+ L+l+eLq+Le+ Le++l+++ +kK e +++qi l k+ el +enk+Lr kle AT4G24540.1 93 NLSRLSKEVEDKTKQLRKLRGEDLDGLNLEELQRLEKLLESGLSRVSEKKGECVMSQIFSLEKRGSELVDENKRLRDKLE 172 6899*************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.59	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.4E-37	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.58E-36	2	69	No hit	No description
PRINTS	PR00404	6.0E-26	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	8.11E-30	3	71	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.9E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-26	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	13.202	87	177	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.8E-17	92	171	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000060	Biological Process	protein import into nucleus, translocation
GO:0009739	Biological Process	response to gibberellin
GO:0010076	Biological Process	maintenance of floral meristem identity
GO:0010077	Biological Process	maintenance of inflorescence meristem identity
GO:0010220	Biological Process	positive regulation of vernalization response
GO:0010582	Biological Process	floral meristem determinacy
GO:0030154	Biological Process	cell differentiation
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048438	Biological Process	floral whorl development
GO:0048510	Biological Process	regulation of timing of transition from vegetative to reproductive phase
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009046	anatomy	flower
PO:0020038	anatomy	petiole
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 220 aa Download sequence Send to blast
MAREKIRIKK IDNITARQVT FSKRRRGIFK KADELSVLCD ADVALIIFSA TGKLFEFSSS 60 RMRDILGRYS LHASNINKLM DPPSTHLRLE NCNLSRLSKE VEDKTKQLRK LRGEDLDGLN 120 LEELQRLEKL LESGLSRVSE KKGECVMSQI FSLEKRGSEL VDENKRLRDK LETLERAKLT 180 TLKEALETES VTTNVSSYDS GTPLEDDSDT SLKLGLPSWE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-18	1	70	1	70	MEF2C
5f28_B	2e-18	1	70	1	70	MEF2C
5f28_C	2e-18	1	70	1	70	MEF2C
5f28_D	2e-18	1	70	1	70	MEF2C
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186513187	0.0
Genevisible	254130_at	0.0
Expression Atlas	AT4G24540	-
AtGenExpress	AT4G24540	-
ATTED-II	AT4G24540	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During vegetative phase, expressed in the entire shoot apical meristem and in emerging leaf primordia. During floral transition, gradually detectable in the transitional shoot apex and young cauline leaves. Detected in the inflorescence meristem. Present throughout the tunica (superficial layers) of the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. At later stages of floral development, weakly expressed in the distal parts of stamens and carpels. Then restricted to pollen and the adaxial surface of the gynoecium. {ECO:0000269\|PubMed:12451184, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:19656343}.
Uniprot	TISSUE SPECIFICITY: Mostly expressed in shoot apical meristems, including floral meristems. Also detected in stems, seedlings, leaves, flowers and siliques, and, to a lower extent, in roots. {ECO:0000269\|PubMed:12451184, ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:12881501, ECO:0000269\|PubMed:19656343}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a MADS-box protein involved in flowering. Regulates the expression of SOC1 and is also upregulated by SOC1. Binds with IMK3 kinase domain. Phosphorylated by IMK3; likely to be a target for IMK3 kinase domain.
UniProt	Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269\|PubMed:12451184, ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:12881501, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18466303, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343}.

Function -- GeneRIF ? help Back to Top
The data provides genetic evidence for the role of AP1 in these interactions by showing that the floral phenotype in the ap1 agl24 svp triple mutant is significantly enhanced. [PMID: 16679456] once AP1 is activated during the floral transition, it acts partly as a master repressor in floral meristems by directly suppressing the expression of flowering time genes SVP, AGL24 and SOC1, preventing continuation of the shoot developmental program [PMID: 17428825] during floral transition, a positive-feedback loop conferred by direct transcriptional regulation between AGL24 and SOC1 at the shoot apex integrates flowering signals [PMID: 18339670] Complementation tests showed that rice OsMADS22 and OsMADS47 are unable to reverse the flowering-time phenotypes of the svp and agl24 mutants in Arabidopsis. [PMID: 18453531] Interaction with AGL24 relocates SOC1 to the nucleus, where SOC1 regulates leafy expression by binding to the LFY promoter. [PMID: 18466303] AP1, AGL24 and SVP redundantly control floral meristem identity. Ectopic AGL24 and SVP expression promotes floral indeterminacy. [PMID: 18694458] AGL24, AP1 and SVP directly and redundantly regulate class B, C and E floral homeotic genes. [PMID: 19656343] Data show that BOP1/2 function distinctly from LFY to upregulate AP1 in floral primordia and that all three activities converge to down-regulate flowering-time regulators including AGAMOUS-LIKE24 in stage 2 floral meristems. [PMID: 20626659] Flowering is controlled by AGL24 partly independently of SOC1 and FUL. [PMID: 22902690]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G24540.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269\|PubMed:12609028, ECO:0000269\|PubMed:14716314, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18339670, ECO:0000269\|PubMed:18694458}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G24260 (R), AT1G69120 (R), AT5G61850 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G24260(R), AT2G45660(A), AT4G18960(R), AT5G61850(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT4G24540, AT4G37940, AT5G13790, AT5G15800, AT5G60910, AT1G24260, AT1G26310, AT1G69120
IntAct	Search O82794

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Delayed flowering. {ECO:0000269\|PubMed:12451184}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G24540

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF005158	0.0	AF005158.1 Arabidopsis thaliana MADS-box Protein (AGL24) mRNA, complete cds.
GenBank	BT025171	0.0	BT025171.1 Arabidopsis thaliana At4g24540 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_194185.1	1e-156	AGAMOUS-like 24
Swissprot	O82794	1e-157	AGL24_ARATH; MADS-box protein AGL24
TrEMBL	A0A178UV29	1e-155	A0A178UV29_ARATH; AGL24
STRING	AT4G24540.1	1e-156	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM14511	15	21
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT4G24540.1
Entrez Gene	828556
iHOP	AT4G24540
wikigenes	AT4G24540

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Pelaz S,Gustafson-Brown C,Kohalmi SE,Crosby WL,Yanofsky MF APETALA1 and SEPALLATA3 interact to promote flower development. Plant J., 2001. 26(4): p. 385-94 [PMID:11439126] Yu H,Xu Y,Tan EL,Kumar PP AGAMOUS-LIKE 24, a dosage-dependent mediator of the flowering signals. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(25): p. 16336-41 [PMID:12451184] Michaels SD, et al. AGL24 acts as a promoter of flowering in Arabidopsis and is positively regulated by vernalization. Plant J., 2003. 33(5): p. 867-74 [PMID:12609028] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Fujita H, et al. An Arabidopsis MADS-box protein, AGL24, is specifically bound to and phosphorylated by meristematic receptor-like kinase (MRLK). Plant Cell Physiol., 2003. 44(7): p. 735-42 [PMID:12881501] Yu H,Ito T,Wellmer F,Meyerowitz EM Repression of AGAMOUS-LIKE 24 is a crucial step in promoting flower development. Nat. Genet., 2004. 36(2): p. 157-61 [PMID:14716314] Fornara F, et al. Functional characterization of OsMADS18, a member of the AP1/SQUA subfamily of MADS box genes. Plant Physiol., 2004. 135(4): p. 2207-19 [PMID:15299121] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Tooke F,Ordidge M,Chiurugwi T,Battey N Mechanisms and function of flower and inflorescence reversion. J. Exp. Bot., 2005. 56(420): p. 2587-99 [PMID:16131510] Gregis V,Sessa A,Colombo L,Kater MM AGL24, SHORT VEGETATIVE PHASE, and APETALA1 redundantly control AGAMOUS during early stages of flower development in Arabidopsis. Plant Cell, 2006. 18(6): p. 1373-82 [PMID:16679456] Trevaskis B, et al. Short vegetative phase-like MADS-box genes inhibit floral meristem identity in barley. Plant Physiol., 2007. 143(1): p. 225-35 [PMID:17114273] Bernier G,P A physiological overview of the genetics of flowering time control. Plant Biotechnol. J., 2005. 3(1): p. 3-16 [PMID:17168895] He C,Saedler H Hormonal control of the inflated calyx syndrome, a morphological novelty, in Physalis. Plant J., 2007. 49(5): p. 935-46 [PMID:17316177] Yadav SR,Prasad K,Vijayraghavan U Divergent regulatory OsMADS2 functions control size, shape and differentiation of the highly derived rice floret second-whorl organ. Genetics, 2007. 176(1): p. 283-94 [PMID:17409064] Liu C, et al. Specification of Arabidopsis floral meristem identity by repression of flowering time genes. Development, 2007. 134(10): p. 1901-10 [PMID:17428825] Liu C, et al. Direct interaction of AGL24 and SOC1 integrates flowering signals in Arabidopsis. Development, 2008. 135(8): p. 1481-91 [PMID:18339670] Alexandre CM,Hennig L FLC or not FLC: the other side of vernalization. J. Exp. Bot., 2008. 59(6): p. 1127-35 [PMID:18390846] Fornara F,Gregis V,Pelucchi N,Colombo L,Kater M The rice StMADS11-like genes OsMADS22 and OsMADS47 cause floral reversions in Arabidopsis without complementing the svp and agl24 mutants. J. Exp. Bot., 2008. 59(8): p. 2181-90 [PMID:18453531] Lee J,Oh M,Park H,Lee I SOC1 translocated to the nucleus by interaction with AGL24 directly regulates leafy. Plant J., 2008. 55(5): p. 832-43 [PMID:18466303] Gregis V,Sessa A,Colombo L,Kater MM AGAMOUS-LIKE24 and SHORT VEGETATIVE PHASE determine floral meristem identity in Arabidopsis. Plant J., 2008. 56(6): p. 891-902 [PMID:18694458] Liu C,Xi W,Shen L,Tan C,Yu H Regulation of floral patterning by flowering time genes. Dev. Cell, 2009. 16(5): p. 711-22 [PMID:19460347] Bertoni G PUCHI and floral meristem identity. Plant Cell, 2009. 21(5): p. 1327 [PMID:19482969] Karim MR,Hirota A,Kwiatkowska D,Tasaka M,Aida M A role for Arabidopsis PUCHI in floral meristem identity and bract suppression. Plant Cell, 2009. 21(5): p. 1360-72 [PMID:19482972] Gregis V,Sessa A,Dorca-Fornell C,Kater MM The Arabidopsis floral meristem identity genes AP1, AGL24 and SVP directly repress class B and C floral homeotic genes. Plant J., 2009. 60(4): p. 626-37 [PMID:19656343] Horvath DP,Sung S,Kim D,Chao W,Anderson J Characterization, expression and function of DORMANCY ASSOCIATED MADS-BOX genes from leafy spurge. Plant Mol. Biol., 2010. 73(1-2): p. 169-79 [PMID:20066557] McCullough E, et al. Photoperiod-dependent floral reversion in the natural allopolyploid Arabidopsis suecica. New Phytol., 2010. 186(1): p. 239-50 [PMID:20074092] Wang Y,Liu C,Yang D,Yu H,Liou YC Pin1At encoding a peptidyl-prolyl cis/trans isomerase regulates flowering time in Arabidopsis. Mol. Cell, 2010. 37(1): p. 112-22 [PMID:20129060] Irish VF The flowering of Arabidopsis flower development. Plant J., 2010. 61(6): p. 1014-28 [PMID:20409275] Xu M, et al. Arabidopsis BLADE-ON-PETIOLE1 and 2 promote floral meristem fate and determinacy in a previously undefined pathway targeting APETALA1 and AGAMOUS-LIKE24. Plant J., 2010. 63(6): p. 974-89 [PMID:20626659] Smith HM,Ung N,Lal S,Courtier J Specification of reproductive meristems requires the combined function of SHOOT MERISTEMLESS and floral integrators FLOWERING LOCUS T and FD during Arabidopsis inflorescence development. J. Exp. Bot., 2011. 62(2): p. 583-93 [PMID:20937733] Yamane H, et al. Expressional regulation of PpDAM5 and PpDAM6, peach (Prunus persica) dormancy-associated MADS-box genes, by low temperature and dormancy-breaking reagent treatment. J. Exp. Bot., 2011. 62(10): p. 3481-8 [PMID:21378115] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Grandi V,Gregis V,Kater MM Uncovering genetic and molecular interactions among floral meristem identity genes in Arabidopsis thaliana. Plant J., 2012. 69(5): p. 881-93 [PMID:22040363] Lee JH,Park SH,Ahn JH Functional conservation and diversification between rice OsMADS22/OsMADS55 and Arabidopsis SVP proteins. Plant Sci., 2012. 185-186: p. 97-104 [PMID:22325870] Thouet J,Quinet M,Lutts S,Kinet JM,P Repression of floral meristem fate is crucial in shaping tomato inflorescence. PLoS ONE, 2012. 7(2): p. e31096 [PMID:22347436] Torti S,Fornara F AGL24 acts in concert with SOC1 and FUL during Arabidopsis floral transition. Plant Signal Behav, 2012. 7(10): p. 1251-4 [PMID:22902690] M The flowering repressor SVP underlies a novel Arabidopsis thaliana QTL interacting with the genetic background. PLoS Genet., 2013. 9(1): p. e1003289 [PMID:23382706] Ding L,Wang Y,Yu H Overexpression of DOSOC1, an ortholog of Arabidopsis SOC1, promotes flowering in the orchid Dendrobium Chao Parya Smile. Plant Cell Physiol., 2013. 54(4): p. 595-608 [PMID:23396600] Liu C, et al. A conserved genetic pathway determines inflorescence architecture in Arabidopsis and rice. Dev. Cell, 2013. 24(6): p. 612-22 [PMID:23537632] Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Lei HJ, et al. Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry. Gene, 2013. 531(2): p. 158-67 [PMID:24055423] Fernandez DE, et al. The MADS-Domain Factors AGAMOUS-LIKE15 and AGAMOUS-LIKE18, along with SHORT VEGETATIVE PHASE and AGAMOUS-LIKE24, Are Necessary to Block Floral Gene Expression during the Vegetative Phase. Plant Physiol., 2014. 165(4): p. 1591-1603 [PMID:24948837] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148] Sun LM,Zhang JZ,Hu CG Characterization and Expression Analysis of PtAGL24, a SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 (SVP/AGL24)-Type MADS-Box Gene from Trifoliate Orange (Poncirus trifoliata L. Raf.). Front Plant Sci, 2016. 7: p. 823 [PMID:27375669]