![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.C00766.1.p | ||||||||
Common Name | LOC105962986, MIMGU_mgv1a015265mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 164aa MW: 18067.1 Da PI: 7.1629 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 39 | 1.7e-12 | 23 | 75 | 5 | 57 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 ++ +r+ +NRe+ArrsR RK++ ++ L v +L+ eN + ++ ++++ Migut.C00766.1.p 23 RKRKRMLSNRESARRSRMRKQKHLDDLMAQVNQLKRENGQILTSVNVTNQHYV 75 67899*********************************998877777666665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.4E-10 | 18 | 68 | No hit | No description |
SMART | SM00338 | 8.4E-20 | 19 | 83 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.369 | 21 | 84 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.75E-12 | 23 | 75 | No hit | No description |
Pfam | PF00170 | 5.4E-10 | 23 | 71 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 8.09E-20 | 24 | 74 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 26 | 41 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009744 | Biological Process | response to sucrose | ||||
GO:0080149 | Biological Process | sucrose induced translational repression | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MASSSGNSAG SEGGDLQNVM DQRKRKRMLS NRESARRSRM RKQKHLDDLM AQVNQLKREN 60 GQILTSVNVT NQHYVHVEAD NSVLRAQMME LTHRLQSLNE ILNYINSSAE IAAAGGGGGS 120 CVFGAEEFQH QGFADGFLNN NPWNNIGGIN QHPIMASAEM FDY* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 22 | 43 | RKRKRMLSNRESARRSRMRKQK |
2 | 35 | 42 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00470 | DAP | Transfer from AT4G34590 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.C00766.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012842789.1 | 1e-118 | PREDICTED: ocs element-binding factor 1 | ||||
Swissprot | O65683 | 6e-44 | BZP11_ARATH; bZIP transcription factor 11 | ||||
TrEMBL | A0A022R250 | 1e-117 | A0A022R250_ERYGU; Uncharacterized protein | ||||
STRING | Migut.C00766.1.p | 1e-118 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA537 | 24 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G34590.1 | 5e-41 | G-box binding factor 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.C00766.1.p |
Entrez Gene | 105962986 |