PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot

Family

WOX

Protein Properties

Length: 105aa MW: 12399.3 Da PI: 10.7428

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Manes.11G137700.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	65.5	7.1e-21	7	66	3	57
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +R+++t+eql +Leel+++ r+p+a+++++++++l +++ ++V++WFqN++a++++ Manes.11G137700.1.p 7 SRWCPTPEQLMILEELYRSgIRTPNASQIQRITSHLslygKIEGKNVFYWFQNHKARDRQ 66 7***************99***********************************996 PP
2	Wus_type_Homeobox	123	1.1e-39	5	67	2	64
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 a++RW+PtpeQ++iLeely+sG+rtPn+++iqrit++L+ yGkie+kNVfyWFQN+kaR+rqk Manes.11G137700.1.p 5 ASSRWCPTPEQLMILEELYRSGIRTPNASQIQRITSHLSLYGKIEGKNVFYWFQNHKARDRQK 67 689***********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	10.139	2	67	IPR001356	Homeobox domain
SMART	SM00389	1.5E-5	4	71	IPR001356	Homeobox domain
Pfam	PF00046	1.2E-18	7	66	IPR001356	Homeobox domain
SuperFamily	SSF46689	7.27E-12	7	67	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	3.1E-8	7	66	IPR009057	Homeodomain-like
CDD	cd00086	4.34E-4	8	67	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0008283	Biological Process	cell proliferation
GO:0009908	Biological Process	flower development
GO:0009943	Biological Process	adaxial/abaxial axis specification
GO:0009947	Biological Process	centrolateral axis specification
GO:0010865	Biological Process	stipule development
GO:0048513	Biological Process	animal organ development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
MSPAASSRWC PTPEQLMILE ELYRSGIRTP NASQIQRITS HLSLYGKIEG KNVFYWFQNH 60 KARDRQKLRR KLLKQLQHNQ IYLQNQSPPF HPLPYHHSPA LLPQV

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:15169755}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Manes.11G137700.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021666132.1	6e-54	WUSCHEL-related homeobox 3-like
Swissprot	Q9SIB4	1e-42	WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBL	A0A2C9V2A3	1e-71	A0A2C9V2A3_MANES; Uncharacterized protein (Fragment)
STRING	cassava4.1_030827m	2e-71	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF10632	29	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G28610.1	5e-39	WOX family protein

Link Out ? help Back to Top
Phytozome	Manes.11G137700.1.p

Publications ? help Back to Top
Chandler JW,Werr W Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation. J. Exp. Bot., 2014. 65(12): p. 3097-110 [PMID:24744428] Niu L, et al. LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula. Plant J., 2015. 81(3): p. 480-92 [PMID:25492397] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Guan C, et al. Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086]