PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

Dof

Protein Properties

Length: 98aa MW: 10635.9 Da PI: 9.0088

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_72873.1	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	106.4	1.5e-33	47	98	2	53
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGg 53 ++++l+cprC s++tkfCyynnys++qPr++C++CrryWt+GG+lr vPvGg MLOC_72873.1 47 QQEKLECPRCSSSDTKFCYYNNYSTAQPRHYCRTCRRYWTHGGTLRKVPVGG 98 67899**********************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	3.0E-21	47	98	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	2.9E-30	49	98	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	26.44	51	98	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	53	89	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
MAPASASLLP AAGAKRPFAA DSAVDAADEG QPLAQQSAVT KKHGESQQEK LECPRCSSSD 60 TKFCYYNNYS TAQPRHYCRT CRRYWTHGGT LRKVPVGG

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_72873.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin and salicylic acid (SA). {ECO:0000269\|PubMed:10758484}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK371500	1e-161	AK371500.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2135N06.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020186822.1	2e-52	dof zinc finger protein DOF1.7-like
Swissprot	Q39088	1e-27	DOF34_ARATH; Dof zinc finger protein DOF3.4
Swissprot	Q9FGD6	1e-27	DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBL	A0A287JMT0	2e-65	A0A287JMT0_HORVV; Uncharacterized protein
STRING	MLOC_72873.1	8e-68	(Hordeum vulgare)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP140	37	367

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G50410.1	1e-29	OBF binding protein 1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]