PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G50410.1

Common Name

DOF3.4, F11C1_250, OBP1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

Dof

Protein Properties

Length: 253aa MW: 26382.2 Da PI: 8.4938

Description

OBF binding protein 1

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G50410.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	122.5	1.5e-38	26	86	2	62
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++++l+cprCds+ntkfCyynny+ sqPr+fCkaCrryWt+GG+lr+vPvGgg+rk+ k+s AT3G50410.1 26 QQEQLPCPRCDSSNTKFCYYNNYNFSQPRHFCKACRRYWTHGGTLRDVPVGGGTRKSAKRS 86 57899***************************************************98875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	4.0E-32	23	84	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	3.3E-33	28	84	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.143	30	84	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	32	68	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009733	Biological Process	response to auxin
GO:0009751	Biological Process	response to salicylic acid
GO:0042545	Biological Process	cell wall modification
GO:0045787	Biological Process	positive regulation of cell cycle
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046872	Molecular Function	metal ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0005660	anatomy	hydathode
PO:0006339	anatomy	juvenile vascular leaf
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020041	anatomy	stipule
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0020147	anatomy	root apical meristem
PO:0020148	anatomy	shoot apical meristem
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 253 aa Download sequence Send to blast
MPTSDSGEPR RIAMKPNGVT VPISDQQEQL PCPRCDSSNT KFCYYNNYNF SQPRHFCKAC 60 RRYWTHGGTL RDVPVGGGTR KSAKRSRTCS NSSSSSVSGV VSNSNGVPLQ TTPVLFPQSS 120 ISNGVTHTVT ESDGKGSALS LCGSFTSTLL NHNAAATATH GSGSVIGIGG FGIGLGSGFD 180 DVSFGLGRAM WPFSTVGTAT TTNVGSNGGH HAVPMPATWQ FEGLESNAGG GFVSGEYFAW 240 PDLSITTPGN SLK

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.20758	0.0	seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145339322	0.0
Genevisible	252210_at	0.0
Expression Atlas	AT3G50410	-
AtGenExpress	AT3G50410	-
ATTED-II	AT3G50410	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Constitutively expressed in the whole plant. {ECO:0000269\|PubMed:10758484, ECO:0000269\|PubMed:8718629}.

Functional Description ? help Back to Top
Source	Description
TAIR	Arabidopsis Dof protein containing a single 51-amino acid zinc finger DNA-binding domain, which may play an important roles in plant growth and development.
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.

Function -- GeneRIF ? help Back to Top
OBP1 controls cell cycle progression by targeting the expression of core cell cycle genes. Overexpression results in a shortening of the cell cycle. [PMID: 18665917]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00402	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G50410.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin and salicylic acid (SA). {ECO:0000269\|PubMed:10758484}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G49620(A), AT2G02820(A), AT2G47730(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	auxin, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G10030
IntAct	Search Q39088

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G50410

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AL132976	0.0	AL132976.2 Arabidopsis thaliana DNA chromosome 3, BAC clone F11C1.
GenBank	CP002686	0.0	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_190610.1	0.0	OBF binding protein 1
Swissprot	Q39088	0.0	DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBL	A0A178VFT5	0.0	A0A178VFT5_ARATH; OBP1
STRING	AT3G50410.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2286	28	74
Representative plant	OGRP38	17	445

Link Out ? help Back to Top
Phytozome	AT3G50410.1
Entrez Gene	824205
iHOP	AT3G50410
wikigenes	AT3G50410

Publications ? help Back to Top
Yanagisawa S,Schmidt RJ Diversity and similarity among recognition sequences of Dof transcription factors. Plant J., 1999. 17(2): p. 209-14 [PMID:10074718] Kang HG,Singh KB Characterization of salicylic acid-responsive, arabidopsis Dof domain proteins: overexpression of OBP3 leads to growth defects. Plant J., 2000. 21(4): p. 329-39 [PMID:10758484] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yanagisawa S The Dof family of plant transcription factors. Trends Plant Sci., 2002. 7(12): p. 555-60 [PMID:12475498] Park DH, et al. The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling. Plant J., 2003. 34(2): p. 161-71 [PMID:12694592] Lijavetzky D,Carbonero P,Vicente-Carbajosa J Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families. BMC Evol. Biol., 2003. 3: p. 17 [PMID:12877745] Kersten B, et al. Generation of Arabidopsis protein chips for antibody and serum screening. Plant Mol. Biol., 2003. 52(5): p. 999-1010 [PMID:14558660] Rodriguez Milla MA,Maurer A,Rodriguez Huete A,Gustafson JP Glutathione peroxidase genes in Arabidopsis are ubiquitous and regulated by abiotic stresses through diverse signaling pathways. Plant J., 2003. 36(5): p. 602-15 [PMID:14617062] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ikeda Y,Banno H,Niu QW,Howell SH,Chua NH The ENHANCER OF SHOOT REGENERATION 2 gene in Arabidopsis regulates CUP-SHAPED COTYLEDON 1 at the transcriptional level and controls cotyledon development. Plant Cell Physiol., 2006. 47(11): p. 1443-56 [PMID:17056621] Chawade A,Br Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors. BMC Genomics, 2007. 8: p. 304 [PMID:17764576] Song YH, et al. Isolation of CONSTANS as a TGA4/OBF4 interacting protein. Mol. Cells, 2008. 25(4): p. 559-65 [PMID:18587275] Skirycz A, et al. The DOF transcription factor OBP1 is involved in cell cycle regulation in Arabidopsis thaliana. Plant J., 2008. 56(5): p. 779-92 [PMID:18665917] Vandepoele K,Quimbaya M,Casneuf T,De Veylder L,Van de Peer Y Unraveling transcriptional control in Arabidopsis using cis-regulatory elements and coexpression networks. Plant Physiol., 2009. 150(2): p. 535-46 [PMID:19357200] Hanada K, et al. Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. Mol. Biol. Evol., 2011. 28(1): p. 377-82 [PMID:20736450] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Zhang B,Chen W,Foley RC,Büttner M,Singh KB Interactions between distinct types of DNA binding proteins enhance binding to ocs element promoter sequences. Plant Cell, 1995. 7(12): p. 2241-52 [PMID:8718629] Chen W,Chao G,Singh KB The promoter of a H2O2-inducible, Arabidopsis glutathione S-transferase gene contains closely linked OBF- and OBP1-binding sites. Plant J., 1996. 10(6): p. 955-66 [PMID:9011080] Vicente-Carbajosa J,Moose SP,Parsons RL,Schmidt RJ A maize zinc-finger protein binds the prolamin box in zein gene promoters and interacts with the basic leucine zipper transcriptional activator Opaque2. Proc. Natl. Acad. Sci. U.S.A., 1997. 94(14): p. 7685-90 [PMID:9207153]