Signature Domain? help Back to Top |
![Signature Domain](draw_signature_domain.php?sp=Ath&pid=AT3G50410.1) |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | zf-Dof | 122.5 | 1.5e-38 | 26 | 86 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
++++l+cprCds+ntkfCyynny+ sqPr+fCkaCrryWt+GG+lr+vPvGgg+rk+ k+s
AT3G50410.1 26 QQEQLPCPRCDSSNTKFCYYNNYNFSQPRHFCKACRRYWTHGGTLRDVPVGGGTRKSAKRS 86
57899***************************************************98875 PP
|
Publications
? help Back to Top |
- Yanagisawa S,Schmidt RJ
Diversity and similarity among recognition sequences of Dof transcription factors. Plant J., 1999. 17(2): p. 209-14 [PMID:10074718] - Kang HG,Singh KB
Characterization of salicylic acid-responsive, arabidopsis Dof domain proteins: overexpression of OBP3 leads to growth defects. Plant J., 2000. 21(4): p. 329-39 [PMID:10758484] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yanagisawa S
The Dof family of plant transcription factors. Trends Plant Sci., 2002. 7(12): p. 555-60 [PMID:12475498] - Park DH, et al.
The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling. Plant J., 2003. 34(2): p. 161-71 [PMID:12694592] - Lijavetzky D,Carbonero P,Vicente-Carbajosa J
Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families. BMC Evol. Biol., 2003. 3: p. 17 [PMID:12877745] - Kersten B, et al.
Generation of Arabidopsis protein chips for antibody and serum screening. Plant Mol. Biol., 2003. 52(5): p. 999-1010 [PMID:14558660] - Rodriguez Milla MA,Maurer A,Rodriguez Huete A,Gustafson JP
Glutathione peroxidase genes in Arabidopsis are ubiquitous and regulated by abiotic stresses through diverse signaling pathways. Plant J., 2003. 36(5): p. 602-15 [PMID:14617062] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Ikeda Y,Banno H,Niu QW,Howell SH,Chua NH
The ENHANCER OF SHOOT REGENERATION 2 gene in Arabidopsis regulates CUP-SHAPED COTYLEDON 1 at the transcriptional level and controls cotyledon development. Plant Cell Physiol., 2006. 47(11): p. 1443-56 [PMID:17056621] - Chawade A,Br
Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors. BMC Genomics, 2007. 8: p. 304 [PMID:17764576] - Song YH, et al.
Isolation of CONSTANS as a TGA4/OBF4 interacting protein. Mol. Cells, 2008. 25(4): p. 559-65 [PMID:18587275] - Skirycz A, et al.
The DOF transcription factor OBP1 is involved in cell cycle regulation in Arabidopsis thaliana. Plant J., 2008. 56(5): p. 779-92 [PMID:18665917] - Vandepoele K,Quimbaya M,Casneuf T,De Veylder L,Van de Peer Y
Unraveling transcriptional control in Arabidopsis using cis-regulatory elements and coexpression networks. Plant Physiol., 2009. 150(2): p. 535-46 [PMID:19357200] - Hanada K, et al.
Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. Mol. Biol. Evol., 2011. 28(1): p. 377-82 [PMID:20736450] - Gaudinier A, et al.
Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Zhang B,Chen W,Foley RC,Büttner M,Singh KB
Interactions between distinct types of DNA binding proteins enhance binding to ocs element promoter sequences. Plant Cell, 1995. 7(12): p. 2241-52 [PMID:8718629] - Chen W,Chao G,Singh KB
The promoter of a H2O2-inducible, Arabidopsis glutathione S-transferase gene contains closely linked OBF- and OBP1-binding sites. Plant J., 1996. 10(6): p. 955-66 [PMID:9011080] - Vicente-Carbajosa J,Moose SP,Parsons RL,Schmidt RJ
A maize zinc-finger protein binds the prolamin box in zein gene promoters and interacts with the basic leucine zipper transcriptional activator Opaque2. Proc. Natl. Acad. Sci. U.S.A., 1997. 94(14): p. 7685-90 [PMID:9207153]
|