PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000378412
Organism
Malus domestica
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family M-type_MADS
Protein Properties Length: 172aa    MW: 19682.6 Da    PI: 8.7437
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000378412genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF793.3e-251962851
                   HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rqvtfskRr gi+KKAeELS+LC+ evaviifs+tgkl++yss
  MDP0000378412 19 ARQVTFSKRRRGIFKKAEELSILCESEVAVIIFSQTGKLFDYSS 62
                   79****************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.7E-29463IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.371464IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-22626IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-23766IPR002100Transcription factor, MADS-box
PfamPF003194.2E-221960IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-222641IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-224162IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MVKRMNEKIK IRRIDYLPAR QVTFSKRRRG IFKKAEELSI LCESEVAVII FSQTGKLFDY  60
SSTRYQYWLW NLRIFVQDQV ASCNRVGPPS NILYSIDYEA KVLTYYSTEY ISTPTHQHPL  120
SEEASSVPES GLLKGTIIGT KCERGLTWKV YLNILASADS EDLTIVESVL Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-14763460MEF2C
5f28_B3e-14763460MEF2C
5f28_C3e-14763460MEF2C
5f28_D3e-14763460MEF2C
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.146153e-66fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During vegetative phase, expressed in the entire shoot apical meristem and in emerging leaf primordia. During floral transition, gradually detectable in the transitional shoot apex and young cauline leaves. Detected in the inflorescence meristem. Present throughout the tunica (superficial layers) of the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. At later stages of floral development, weakly expressed in the distal parts of stamens and carpels. Then restricted to pollen and the adaxial surface of the gynoecium. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:19656343}.
UniprotTISSUE SPECIFICITY: Mostly expressed in shoot apical meristems, including floral meristems. Also detected in stems, seedlings, leaves, flowers and siliques, and, to a lower extent, in roots. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:19656343}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5047177e-89AB504717.1 Pyrus pyrifolia var. culta PpMADS13-2 mRNA for dormancy-associated MADS-box transcription factor, complete cds.
GenBankAB7744757e-89AB774475.1 Pyrus pyrifolia var. culta PpMADS13-2tw mRNA for dormancy-associated MADS-box transcription factor, complete cds, cultivar: TP-85-119.
GenBankKP1640277e-89KP164027.1 Pyrus pyrifolia clone PpDAM1 DAM1-like MADS-box protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotO827945e-24AGL24_ARATH; MADS-box protein AGL24
STRINGXP_008347814.11e-124(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24540.12e-26AGAMOUS-like 24
Publications ? help Back to Top
  1. Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP
    Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae).
    PLoS ONE, 2013. 8(6): p. e67243
    [PMID:23840638]
  2. Lei HJ, et al.
    Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry.
    Gene, 2013. 531(2): p. 158-67
    [PMID:24055423]
  3. Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG
    A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch].
    BMC Plant Biol., 2015. 15: p. 41
    [PMID:25848674]
  4. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]
  5. Sun LM,Zhang JZ,Hu CG
    Characterization and Expression Analysis of PtAGL24, a SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 (SVP/AGL24)-Type MADS-Box Gene from Trifoliate Orange (Poncirus trifoliata L. Raf.).
    Front Plant Sci, 2016. 7: p. 823
    [PMID:27375669]