![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj3g3v0966230.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 160aa MW: 18614.5 Da PI: 10.1267 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 169 | 1.5e-52 | 11 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrFhP+deelv++yL kkv++++ l + +vd++k+ePwd+p+++ + kewyf+++rd+kyatg r+nrat+sgyWkatgkd+++++ Lj3g3v0966230.1 11 LPPGFRFHPRDEELVCDYLMKKVTHSDSLL---MIDVDLNKCEPWDIPATACVGGKEWYFYTQRDRKYATGLRTNRATSSGYWKATGKDRAIHR 101 79**********************999544...789************7777799**************************************9 PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+lvg++ktLvfy+grapkg+kt+Wvmhe+r+ Lj3g3v0966230.1 102 -RGTLVGMRKTLVFYQGRAPKGRKTEWVMHEFRI 134 .999****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.23E-61 | 2 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.02 | 11 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.0E-28 | 12 | 134 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MSNISMVEAK LPPGFRFHPR DEELVCDYLM KKVTHSDSLL MIDVDLNKCE PWDIPATACV 60 GGKEWYFYTQ RDRKYATGLR TNRATSSGYW KATGKDRAIH RRGTLVGMRK TLVFYQGRAP 120 KGRKTEWVMH EFRIEGPHGP PKIPSSKEDW VLCRVFYKSR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-51 | 6 | 159 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-51 | 6 | 159 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-51 | 6 | 159 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-51 | 6 | 159 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 7e-51 | 6 | 159 | 15 | 169 | NAC domain-containing protein 19 |
3swm_B | 7e-51 | 6 | 159 | 15 | 169 | NAC domain-containing protein 19 |
3swm_C | 7e-51 | 6 | 159 | 15 | 169 | NAC domain-containing protein 19 |
3swm_D | 7e-51 | 6 | 159 | 15 | 169 | NAC domain-containing protein 19 |
3swp_A | 7e-51 | 6 | 159 | 15 | 169 | NAC domain-containing protein 19 |
3swp_B | 7e-51 | 6 | 159 | 15 | 169 | NAC domain-containing protein 19 |
3swp_C | 7e-51 | 6 | 159 | 15 | 169 | NAC domain-containing protein 19 |
3swp_D | 7e-51 | 6 | 159 | 15 | 169 | NAC domain-containing protein 19 |
4dul_A | 8e-51 | 6 | 159 | 12 | 166 | NAC domain-containing protein 19 |
4dul_B | 8e-51 | 6 | 159 | 12 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.7609 | 0.0 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj3g3v0966230.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF725687 | 1e-179 | KF725687.1 Ammopiptanthus mongolicus NAC domain-containing protein (NAC3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003595973.1 | 1e-113 | NAC domain-containing protein 21/22 | ||||
Refseq | XP_027343628.1 | 1e-113 | NAC domain-containing protein 21/22-like | ||||
Swissprot | Q84TE6 | 3e-90 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | W0C8Y8 | 1e-112 | W0C8Y8_9FABA; NAC domain-containing protein | ||||
STRING | AES66224 | 1e-112 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10010 | 32 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56010.2 | 1e-92 | NAC domain containing protein 1 |