 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Lj0g3v0337759.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
| Family |
G2-like |
| Protein Properties |
Length: 124aa MW: 13779.9 Da PI: 9.7287 |
| Description |
G2-like family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Lj0g3v0337759.1 | genome | Kazusa | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | G2-like | 67.4 | 2.5e-21 | 75 | 124 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
kprl+Wt eL +rF+ a++qL G +kA Pk+ilelm+v+gL ++hv SHLQ
Lj0g3v0337759.1 75 KPRLVWTAELQTRFLAAISQL-GLDKAKPKRILELMNVEGLLITHVTSHLQ 124
79*******************.****************************9 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in pollen. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:15173562, ECO:0000269|PubMed:9891419}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}. |
| Publications
? help Back to Top |
- Takahashi N, et al.
Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
Curr. Biol., 2013. 23(18): p. 1812-7
[PMID:24035544] - Ge XM, et al.
Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
Plant J., 2015. 82(1): p. 138-50
[PMID:25704455] - Takahashi N,Umeda M
Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
Plant Signal Behav, 2014. 9(8): p. e29396
[PMID:25763620] - Kobayashi K, et al.
Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
Plant Physiol., 2017. 173(4): p. 2340-2355
[PMID:28193764] - Arnaud D, et al.
Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
Plant Cell, 2017. 29(3): p. 543-559
[PMID:28254779] - Zhang TQ, et al.
A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
Plant Cell, 2017. 29(5): p. 1073-1087
[PMID:28389585] - Meng WJ, et al.
Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
Plant Cell, 2017. 29(6): p. 1357-1372
[PMID:28576846] - Zhang F,May A,Irish VF
Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
Trends Plant Sci., 2017. 22(10): p. 815-817
[PMID:28886911] - Takatsuka H,Higaki T,Umeda M
Actin Reorganization Triggers Rapid Cell Elongation in Roots.
Plant Physiol., 2018. 178(3): p. 1130-1141
[PMID:30185441]
|
