![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV44852.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 121aa MW: 14393.7 Da PI: 9.9202 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 152.7 | 8.2e-48 | 11 | 116 | 2 | 108 |
CG-1 2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcyw 100 ++ k+rwl+++ei+aiL nf+ +++ ++ + pksg+++L++rk++r+frkDGy+wkkkkdgktv+E+he+LKvg+ e +++yYah+e+ ptf rrcyw KZV44852.1 11 VEAKARWLRPNEIHAILCNFKYFTVNVKPVNLPKSGTIVLFDRKMFRNFRKDGYKWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYW 109 6779*********************************************************************************************** PP CG-1 101 lLeeelek 108 lL++ e+ KZV44852.1 110 LLDKY-EN 116 **987.44 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51437 | 63.402 | 6 | 121 | IPR005559 | CG-1 DNA-binding domain |
SMART | SM01076 | 1.1E-60 | 9 | 118 | IPR005559 | CG-1 DNA-binding domain |
Pfam | PF03859 | 1.3E-41 | 12 | 115 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
LIDLDVGAIM VEAKARWLRP NEIHAILCNF KYFTVNVKPV NLPKSGTIVL FDRKMFRNFR 60 KDGYKWKKKK DGKTVKEAHE HLKVGNEERI HVYYAHGEDS PTFVRRCYWL LDKYENTNTF 120 C |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:14581622). Binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in response to cold. Contributes together with CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:14581622, ECO:0000269|PubMed:28351986, ECO:0000305|PubMed:11925432}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV44852.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat shock, UVB, wounding, abscisic acid, H(2)O(2) and salicylic acid. {ECO:0000269|PubMed:12218065}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003547365.1 | 9e-66 | calmodulin-binding transcription activator 5 | ||||
Refseq | XP_008223308.1 | 7e-66 | PREDICTED: calmodulin-binding transcription activator 5-like isoform X1 | ||||
Refseq | XP_022874687.1 | 9e-67 | calmodulin-binding transcription activator 5-like isoform X1 | ||||
Refseq | XP_022874688.1 | 9e-67 | calmodulin-binding transcription activator 5-like isoform X1 | ||||
Refseq | XP_022874689.1 | 9e-67 | calmodulin-binding transcription activator 5-like isoform X2 | ||||
Refseq | XP_028204125.1 | 9e-66 | calmodulin-binding transcription activator 5-like | ||||
Swissprot | O23463 | 1e-58 | CMTA5_ARATH; Calmodulin-binding transcription activator 5 | ||||
TrEMBL | A0A2Z7CCV0 | 2e-85 | A0A2Z7CCV0_9LAMI; Calmodulin-binding transcription activator 5-like (Fragment) | ||||
STRING | Lus10041126 | 7e-67 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA14489 | 8 | 11 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16150.1 | 1e-55 | calmodulin binding;transcription regulators |
Publications ? help Back to Top | |||
---|---|---|---|
|